BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n09f (455 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21667| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_53765| Best HMM Match : 3HCDH_N (HMM E-Value=9.2e-12) 40 0.001 SB_8863| Best HMM Match : DAO (HMM E-Value=0.04) 32 0.20 SB_22397| Best HMM Match : DAO (HMM E-Value=7.6e-06) 31 0.34 SB_57609| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_29581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_16736| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) 29 1.8 SB_44903| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_54640| Best HMM Match : TolA (HMM E-Value=1.7) 28 3.2 SB_57235| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_45640| Best HMM Match : Epimerase (HMM E-Value=9.4e-38) 27 5.6 SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) 27 5.6 SB_4519| Best HMM Match : ZU5 (HMM E-Value=0.28) 27 5.6 SB_50723| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_17988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_9370| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_21667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 812 Score = 42.7 bits (96), Expect = 1e-04 Identities = 33/111 (29%), Positives = 55/111 (49%), Gaps = 1/111 (0%) Frame = +3 Query: 75 IGIVGSGLIGRSWAMLFASVGYQVTVYDVVAKQITDAIEDIKYQLHTLENDGLLRGELKA 254 + ++G+GL+G A A G +V +YD A+ A+E K L + + L R E+ A Sbjct: 8 VAVIGAGLMGTCIAGELAYHGARVNLYDRSAQ----AMEKSKEML-IQQKEQLKREEVMA 62 Query: 255 SEQF-QCIKGSTDLETAVKGAIFVQECVPENLDLKKKVFQNLDSVVDDNTI 404 + F + LE AV + + E ENL++KK VF+++ N + Sbjct: 63 TSDFIGTVAFCESLEEAVVNSGLIFEATIENLEVKKSVFKSISQFCRTNAV 113 >SB_53765| Best HMM Match : 3HCDH_N (HMM E-Value=9.2e-12) Length = 120 Score = 39.9 bits (89), Expect = 0.001 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = +3 Query: 327 ECVPENLDLKKKVFQNLDSVVDDNTI 404 EC PENL+LKKKVFQNL++ + + + Sbjct: 1 ECTPENLELKKKVFQNLEATLSSSEV 26 >SB_8863| Best HMM Match : DAO (HMM E-Value=0.04) Length = 485 Score = 32.3 bits (70), Expect = 0.20 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 72 KIGIVGSGLIGRSWAMLFASVGYQVTVYD 158 ++ IVG GL+G A+ FA GY+V +Y+ Sbjct: 165 EVAIVGGGLVGALSAVFFAKRGYKVDLYE 193 >SB_22397| Best HMM Match : DAO (HMM E-Value=7.6e-06) Length = 456 Score = 31.5 bits (68), Expect = 0.34 Identities = 12/35 (34%), Positives = 24/35 (68%) Frame = +3 Query: 48 MASKFKSEKIGIVGSGLIGRSWAMLFASVGYQVTV 152 ++S F +++ ++G+G+IG + A + GY+VTV Sbjct: 13 LSSPFGGQRVLVIGAGVIGLTTAYELLTAGYEVTV 47 >SB_57609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +3 Query: 72 KIGIVGSGLIGRSWAMLFASVGYQVTVYD 158 K+GIVGSG+ G S A L G +V +Y+ Sbjct: 2 KVGIVGSGIAGLSAAWLLTLRGNEVHLYE 30 >SB_29581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.5 bits (63), Expect = 1.4 Identities = 22/62 (35%), Positives = 29/62 (46%) Frame = -1 Query: 326 LNKYSSFNCGFQIRRPFYTLKLFASFELAS*QTIVFKGMQLVFDVLNGIGNLFCDYIIYS 147 +++Y C +I P KL A+ E A I+ KG VFD L GN+ IY Sbjct: 22 MSQYGRLFCSTRIPHPGKD-KL-ATHEGARHMLIMHKGKFFVFDTLTTDGNIVSTSTIYE 79 Query: 146 NL 141 NL Sbjct: 80 NL 81 >SB_16736| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) Length = 765 Score = 29.1 bits (62), Expect = 1.8 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 2/72 (2%) Frame = +3 Query: 174 ITDAIEDIKYQLHTLENDGLLRGELKASEQFQCIKGSTDLETAVKGAIFVQECVPENLD- 350 + AIE + EN L+ GE+ S+ + T L VK I V E+L Sbjct: 105 LAQAIERCRMNEMRKENRDLVLGEINKSDSMRICVDLTQLNEGVKWEIQPMPSVDESLSK 164 Query: 351 -LKKKVFQNLDS 383 + KVF LD+ Sbjct: 165 LSQGKVFSKLDA 176 >SB_44903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1281 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 89 SNDPDLFRLEFRCHDYCRCDRTARQTSRE 3 S D RLE CH C CD+ + SR+ Sbjct: 79 SKQSDKARLEKMCHPLCSCDKCEKLLSRK 107 >SB_54640| Best HMM Match : TolA (HMM E-Value=1.7) Length = 589 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 99 IGRSWAMLFASVGYQVTVYDVVAKQITDAIEDIKYQ 206 +GR W + ++ +QV D V KQ A++D Y+ Sbjct: 1 MGRLWILAIPAIIWQVCTTDAVRKQQLRAVDDETYK 36 >SB_57235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 294 ETAVKGAIFVQECVPENLDLKKKVFQNLDS 383 ++A +G V++C+ N D+K K + LDS Sbjct: 20 QSATRGLALVKDCLMANTDVKGKGIKRLDS 49 >SB_45640| Best HMM Match : Epimerase (HMM E-Value=9.4e-38) Length = 451 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 87 GSGLIGRSWAMLFASVGYQVTVYD 158 G+G +G S + GY+VTVYD Sbjct: 148 GAGYLGSSLVPILLDQGYKVTVYD 171 >SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) Length = 332 Score = 27.5 bits (58), Expect = 5.6 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 90 SGLIGRSWAMLFASVGYQVTVYDVVAK--QITDAIEDIKYQ 206 S L+G+SW L S G Q+ D + K Q+ I+ I YQ Sbjct: 173 SRLLGQSWNQLALSTGTQLMESDAMIKFGQLCWEIQSIMYQ 213 >SB_4519| Best HMM Match : ZU5 (HMM E-Value=0.28) Length = 403 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 240 GELKASEQFQCIKGSTDLETAVKGAIFVQECV 335 G LK S + QC++ S + +V G +FV V Sbjct: 125 GALKQSVEIQCVRHSPTVFPSVDGEVFVSHIV 156 >SB_50723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 26.6 bits (56), Expect = 9.7 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 341 LWNTFLNKYSSFNCGFQIRRPFYTLKLFAS 252 +WN +++K NC F + P Y + S Sbjct: 110 VWNRYMDKLPERNCWFAVLEPAYITLFYQS 139 >SB_17988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 26.6 bits (56), Expect = 9.7 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 273 IKGSTDLETAVKGAIFVQECVPENLDLKKKVFQNLD 380 +K S D+ +V A V E + ENL K K+F LD Sbjct: 13 LKISLDVPGSVADADLVIEAIVENLRTKHKLFTALD 48 >SB_9370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 26.6 bits (56), Expect = 9.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 63 KSEKIGIVGSGLIGRSWAMLFASVGYQVTVYD 158 KS K+ IVGSG+ G A S G VT+ + Sbjct: 249 KSPKVIIVGSGIAGLMAARQLQSFGIDVTMVE 280 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,388,935 Number of Sequences: 59808 Number of extensions: 287101 Number of successful extensions: 725 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 725 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 920703675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -