BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n03r (326 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_57641| Best HMM Match : FYVE (HMM E-Value=2.9) 29 1.2 SB_42739| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-21) 27 2.7 SB_27281| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.6 SB_11829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 26 6.3 SB_28466| Best HMM Match : Drf_FH1 (HMM E-Value=2.1) 26 6.3 SB_30069| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 >SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1211 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 143 KHVSPMLIMTILGFAYSSKLTTLNAVVDRIDRKPSPGLS 259 +HVS ++ +L + Y+SK T + VDRI R G + Sbjct: 140 EHVSSEVLGNLLRWRYNSKFLTTGSPVDRIPRYTQLGFT 178 >SB_57641| Best HMM Match : FYVE (HMM E-Value=2.9) Length = 97 Score = 28.7 bits (61), Expect = 1.2 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 302 IENIKFCKQCQNHTMINLARVCDLCDQL-QHLEW 204 +E KF CQ ++ L +CDLC L HL + Sbjct: 23 VETRKFTINCQRLCLVCLMTICDLCRMLDDHLRF 56 >SB_42739| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-21) Length = 683 Score = 27.5 bits (58), Expect = 2.7 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -3 Query: 252 PGEGLRSMRSTTAFRVVNFEL-YAKPNIVIMSIGLTCFGLALGY-IAYMRQKYESM 91 PG+ L S S + +V F L Y P IVIM G L Y IA++R + + Sbjct: 187 PGDSLSSFPSYRTYHMVRFMLNYILP-IVIMIAAYGALGFRLKYHIAFIRTVHSEL 241 >SB_27281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 27.1 bits (57), Expect = 3.6 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Frame = +2 Query: 89 PIDSYFCRMYAMYPRAKPKHVSPMLIMTILGFAYSSKLTTLNAVVDRI-----DRKPSPG 253 P++ + CR A+Y + P +L+ L + + + T V+ ++ + KPSP Sbjct: 267 PLEEFLCRKAALYKKTPPSEDDCLLLALELLYVWRAFYTCSQPVLHKMLQDLRNSKPSPQ 326 Query: 254 L 256 L Sbjct: 327 L 327 >SB_11829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 495 Score = 26.6 bits (56), Expect = 4.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 296 NIKFCKQCQNHTMINLARVCDLCDQLQH 213 N+ +C CQ+ +A C C QL+H Sbjct: 124 NVCYCSMCQHKVAQQVACNCPSCLQLRH 151 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -1 Query: 323 IALRLPFIENIKFCKQ--CQNHTMINLARVCDLCDQL 219 I+L+ ++ CK CQ+H L +CD CD+L Sbjct: 137 ISLQEATAKSTTSCKSHYCQHHKEEKLILLCDTCDKL 173 >SB_28466| Best HMM Match : Drf_FH1 (HMM E-Value=2.1) Length = 331 Score = 26.2 bits (55), Expect = 6.3 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 255 KP-GEGLRSMRSTTAFRVVNFELYAKPNIVIMSIGLTCF 142 KP GE + + +A VV E +K NIV + G TCF Sbjct: 181 KPAGEVEQEETAKSADEVVPCESISKKNIVFRTTGTTCF 219 >SB_30069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 140 VWL*DTLHTCDKNMNQWDIILLLIKMEKRFLKRR 39 V+ DT +TC++ + W + LL+ + KRR Sbjct: 50 VYTSDTFYTCERELGLWRALPLLVPNDHLPNKRR 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,511,821 Number of Sequences: 59808 Number of extensions: 199313 Number of successful extensions: 442 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 450550116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -