BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n03r (326 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49590.2 68416.m05420 expressed protein 27 3.0 At3g49590.1 68416.m05419 expressed protein 27 3.0 At1g29170.1 68414.m03569 expressed protein ; expression supporte... 27 3.9 At3g05670.1 68416.m00631 PHD finger family protein contains Pfam... 26 5.2 At1g71960.1 68414.m08318 ABC transporter family protein similar ... 26 5.2 At5g58460.1 68418.m07321 cation/hydrogen exchanger, putative (CH... 25 9.0 At5g46110.1 68418.m05669 phosphate/triose-phosphate translocator... 25 9.0 At4g30825.1 68417.m04371 pentatricopeptide (PPR) repeat-containi... 25 9.0 >At3g49590.2 68416.m05420 expressed protein Length = 603 Score = 27.1 bits (57), Expect = 3.0 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +2 Query: 227 RIDRKPSPGLSSCGFDIVYKI 289 R+ R+ S L+S G+D++YK+ Sbjct: 166 RVSRQLSSSLASSGYDLIYKV 186 >At3g49590.1 68416.m05419 expressed protein Length = 603 Score = 27.1 bits (57), Expect = 3.0 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +2 Query: 227 RIDRKPSPGLSSCGFDIVYKI 289 R+ R+ S L+S G+D++YK+ Sbjct: 166 RVSRQLSSSLASSGYDLIYKV 186 >At1g29170.1 68414.m03569 expressed protein ; expression supported by MPSS Length = 1016 Score = 26.6 bits (56), Expect = 3.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 191 SSKLTTLNAVVDRIDRKPSPGLSSCGFD 274 +S++ N+VVD +D KPS G G D Sbjct: 337 ASEMVEANSVVDTLDEKPSYGEGIGGVD 364 >At3g05670.1 68416.m00631 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 883 Score = 26.2 bits (55), Expect = 5.2 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -1 Query: 299 ENIKFCKQCQNHTMINLARVCDLCDQLQH 213 ENI C +C L +CDLCD H Sbjct: 502 ENI-ICTECHQGDDDGLMLLCDLCDSSAH 529 >At1g71960.1 68414.m08318 ABC transporter family protein similar to breast cancer resistance protein GB:AAC97367 from [Homo sapiens] Length = 662 Score = 26.2 bits (55), Expect = 5.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 149 VSPMLIMTILGFAYSSKLTTLNAVVDRI 232 +SP M +LG + S K T LNAV R+ Sbjct: 91 ISPGEFMAVLGPSGSGKSTLLNAVAGRL 118 >At5g58460.1 68418.m07321 cation/hydrogen exchanger, putative (CHX25) similar to Na+/H+-exchanging protein slr1595, Synechocystis sp., PIR:S74951; monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 857 Score = 25.4 bits (53), Expect = 9.0 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +2 Query: 140 PKHVSPMLIMTILGFAYSSKLTTLNAVVDRIDRKPS 247 PK +SP++ M+I+GF +T A+ ++ + S Sbjct: 378 PKQISPLIYMSIVGFVTKFVSSTGAALFFKVPTRDS 413 >At5g46110.1 68418.m05669 phosphate/triose-phosphate translocator, putative identical to phosphate/triose-phosphate translocator precursor [Arabidopsis thaliana] gi|3983125|gb|AAC83815; similar to triose phosphate/phosphate translocator, chloroplast precursor (CTPT)[Cauliflower]{Brassica oleracea} SWISS-PROT:P52177 Length = 410 Score = 25.4 bits (53), Expect = 9.0 Identities = 9/43 (20%), Positives = 24/43 (55%) Frame = +3 Query: 3 FYKFYNFNPILISSFQKSLFHLYQ*QNNIPLIHIFVACMQCIL 131 F+ +Y N ++ + K +++ + + +IH+FV + C++ Sbjct: 112 FFMWYFLN-VIFNILNKKIYNYFPYPYFVSVIHLFVGVVYCLI 153 >At4g30825.1 68417.m04371 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 904 Score = 25.4 bits (53), Expect = 9.0 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 260 MINLARVCDLCDQLQHLEWSI 198 M+ + + CDL D+LQHL + I Sbjct: 635 MLRIYQKCDLQDKLQHLYYRI 655 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,442,201 Number of Sequences: 28952 Number of extensions: 142314 Number of successful extensions: 361 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 370553816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -