BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10n01r (757 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 7.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.4 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 9.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 540 QLAVYQFLQYPPDVLRKVC 596 Q VYQF+ P D++ C Sbjct: 533 QRLVYQFVDVPKDIIEIDC 551 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 501 LVLFALD*WLCTLQLAVYQFLQYPPDVLRKVCFLHVALL 617 L+L LD CT++ + + P +LRK L +A++ Sbjct: 384 LILIGLDSQFCTVEGFITAAVDEWPRLLRKRKELFIAIV 422 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 501 LVLFALD*WLCTLQLAVYQFLQYPPDVLRKVCFLHVALL 617 L+L LD CT++ + + P +LRK L +A++ Sbjct: 437 LILIGLDSQFCTVEGFITAAVDEWPRLLRKRKELFIAIV 475 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 619 SSNATCKKHTFRRTSGG 569 S++ TC HT R +GG Sbjct: 287 SASTTCSGHTVRCFTGG 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,546 Number of Sequences: 438 Number of extensions: 4699 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -