BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m24f (575 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y11593-1|CAA72332.1| 369|Homo sapiens putative septin protein. 58 3e-08 U74628-1|AAB93438.1| 369|Homo sapiens cell division control rel... 58 3e-08 CR456545-1|CAG30431.1| 369|Homo sapiens PNUTL1 protein. 58 3e-08 BC025261-1|AAH25261.1| 369|Homo sapiens septin 5 protein. 58 3e-08 AF006988-1|AAC39779.1| 369|Homo sapiens septin protein. 58 3e-08 U88870-1|AAD00657.1| 459|Homo sapiens cell division control-rel... 57 4e-08 U88829-1|AAD00653.1| 478|Homo sapiens cell division control-rel... 57 4e-08 U59632-1|AAB93436.1| 385|Homo sapiens H5 protein. 57 4e-08 D89278-1|BAB46922.1| 478|Homo sapiens cerebral protein-7 protein. 57 4e-08 CR457111-1|CAG33392.1| 478|Homo sapiens PNUTL2 protein. 57 4e-08 BC018056-1|AAH18056.3| 459|Homo sapiens septin 4 protein. 57 4e-08 AF176379-1|AAG45673.1| 274|Homo sapiens ARTS protein protein. 57 4e-08 AF073312-1|AAC25673.1| 478|Homo sapiens peanut-like 2 protein. 57 4e-08 AF035811-1|AAB88512.1| 478|Homo sapiens protein H5 protein. 57 4e-08 AF006988-2|AAC39780.1| 417|Homo sapiens septin protein. 57 4e-08 AB008753-1|BAB70695.1| 478|Homo sapiens Bradeion beta protein. 57 4e-08 AK056273-1|BAB71133.1| 346|Homo sapiens protein ( Homo sapiens ... 56 7e-08 AF061153-1|AAC25957.1| 336|Homo sapiens MLL/hCDCrel fusion prot... 56 7e-08 AF061152-1|AAC25956.1| 336|Homo sapiens MLL/hCDCrel fusion prot... 56 7e-08 AB209168-1|BAD92405.1| 394|Homo sapiens H5 variant protein. 56 7e-08 BC107718-1|AAI07719.1| 235|Homo sapiens SEPT7 protein protein. 55 2e-07 BC012161-1|AAH12161.1| 367|Homo sapiens septin 1 protein. 54 4e-07 AY034176-1|AAK61491.1| 372|Homo sapiens septin 1 protein. 54 4e-07 AF085235-1|AAL40393.1| 366|Homo sapiens LARP protein. 54 4e-07 D63878-1|BAA09928.2| 367|Homo sapiens KIAA0158 protein. 53 8e-07 D28540-1|BAA05893.1| 406|Homo sapiens Human Diff6,H5,CDC10 homo... 53 8e-07 DQ232879-1|ABB17294.1| 417|Homo sapiens septin 7 protein. 53 8e-07 BC067264-1|AAH67264.2| 417|Homo sapiens septin 7 protein. 53 8e-07 BC033559-1|AAH33559.1| 371|Homo sapiens SEPT2 protein protein. 53 8e-07 BC025987-1|AAH25987.3| 417|Homo sapiens septin 7 protein. 53 8e-07 BC014455-1|AAH14455.1| 361|Homo sapiens septin 2 protein. 53 8e-07 AF038404-1|AAB92377.1| 361|Homo sapiens homolog of Nedd5 protein. 53 8e-07 AC104841-1|AAY14718.1| 318|Homo sapiens unknown protein. 53 8e-07 S72008-1|AAB31337.1| 418|Homo sapiens hCDC10 protein. 52 2e-06 BC093642-1|AAH93642.2| 418|Homo sapiens septin 7 protein. 52 2e-06 BC093640-1|AAH93640.2| 418|Homo sapiens septin 7 protein. 52 2e-06 AB209677-1|BAD92914.1| 381|Homo sapiens CDC10 protein variant p... 52 2e-06 AB073389-1|BAE45719.1| 418|Homo sapiens predicted protein produ... 52 2e-06 AF061154-1|AAC25958.1| 82|Homo sapiens MLL/hCDCrel fusion prot... 44 3e-04 U85431-1|AAD00564.1| 150|Homo sapiens unknown protein protein. 42 0.002 Z99716-6|CAI41693.1| 350|Homo sapiens septin 3 protein. 37 0.044 CR456572-1|CAG30458.1| 350|Homo sapiens SEPT3 protein. 37 0.044 BC111779-1|AAI11780.2| 345|Homo sapiens septin 3 protein. 37 0.044 AF285109-1|AAG00519.1| 337|Homo sapiens septin 3 isoform B prot... 37 0.044 AF285108-1|AAG00518.1| 70|Homo sapiens septin 3 isoform C prot... 37 0.044 AF285107-1|AAG00517.1| 345|Homo sapiens septin 3 isoform A prot... 37 0.044 BT007215-1|AAP35879.1| 568|Homo sapiens MLL septin-like fusion ... 37 0.059 BC114550-1|AAI14551.1| 341|Homo sapiens SEPT9 protein protein. 37 0.059 BC054004-1|AAH54004.1| 422|Homo sapiens SEPT9 protein protein. 37 0.059 BC021192-1|AAH21192.1| 568|Homo sapiens septin 9 protein. 37 0.059 AK022493-1|BAB14057.1| 196|Homo sapiens protein ( Homo sapiens ... 37 0.059 AJ312322-1|CAC42224.1| 422|Homo sapiens OVARIAN/Breast septin b... 37 0.059 AJ312321-1|CAC42223.1| 568|Homo sapiens OVARIAN/Breast septin a... 37 0.059 AJ312320-1|CAC42222.1| 335|Homo sapiens OVARIAN/Breast septin d... 37 0.059 AJ312319-1|CAC42221.1| 579|Homo sapiens OVARIAN/Breast septin g... 37 0.059 AF189713-1|AAF23374.1| 586|Homo sapiens MLL septin-like fusion ... 37 0.059 AF189712-1|AAF23373.1| 422|Homo sapiens MLL septin-like fusion ... 37 0.059 AF142408-1|AAG27919.1| 568|Homo sapiens cell division control p... 37 0.059 AF123052-1|AAD39749.1| 568|Homo sapiens MLL septin-like fusion ... 37 0.059 AB023208-1|BAA76835.2| 630|Homo sapiens KIAA0991 protein protein. 37 0.059 D86957-1|BAA13193.1| 508|Homo sapiens KIAA0202 protein. 32 1.7 AF440763-1|AAO13880.1| 453|Homo sapiens septin SEPT8_v3 protein. 32 1.7 AF440762-1|AAO13879.1| 562|Homo sapiens septin SEPT8_v2 protein. 32 1.7 AF440761-1|AAO13878.1| 508|Homo sapiens septin SEPT8_v1* protein. 32 1.7 AF179995-1|AAG09407.1| 508|Homo sapiens septin 2 protein. 32 1.7 D50918-1|BAA09477.1| 424|Homo sapiens KIAA0128 protein. 31 2.2 BC069231-1|AAH69231.1| 427|Homo sapiens septin 6 protein. 31 2.2 BC036240-1|AAH36240.1| 434|Homo sapiens septin 6 protein. 31 2.2 BC011922-1|AAH11922.3| 429|Homo sapiens septin 6 protein. 31 2.2 BC009291-1|AAH09291.1| 434|Homo sapiens septin 6 protein. 31 2.2 AY679521-1|AAT80339.1| 438|Homo sapiens septin 6 isoform E prot... 31 2.2 AY034177-1|AAK61492.1| 427|Homo sapiens septin 6 protein. 31 2.2 AY005981-1|AAF97496.1| 427|Homo sapiens septin 6 protein. 31 2.2 AL355348-4|CAI41428.1| 427|Homo sapiens septin 6 protein. 31 2.2 AL355348-3|CAI41427.1| 431|Homo sapiens septin 6 protein. 31 2.2 AL355348-2|CAI41426.1| 434|Homo sapiens septin 6 protein. 31 2.2 AL355348-1|CAI41425.1| 429|Homo sapiens septin 6 protein. 31 2.2 AF512946-1|AAM82548.1| 559|Homo sapiens MLL/SEPTIN6 fusion prot... 31 2.2 AF512945-1|AAM82547.1| 496|Homo sapiens MLL/SEPTIN6 fusion prot... 31 2.2 AF512944-1|AAM82546.1| 265|Homo sapiens MLL/SEPTIN6 fusion prot... 31 2.2 AF512943-1|AAM82545.1| 470|Homo sapiens MLL/SEPTIN6 fusion prot... 31 2.2 AF403062-1|AAK98551.1| 429|Homo sapiens SEPTIN6 type V protein. 31 2.2 AF403061-1|AAK98550.1| 267|Homo sapiens SEPTIN6 type IV protein. 31 2.2 AF403060-1|AAK98549.1| 427|Homo sapiens SEPTIN6 type III protein. 31 2.2 AF403059-1|AAK98548.1| 434|Homo sapiens SEPTIN6 type II protein. 31 2.2 AF403058-1|AAK98547.1| 427|Homo sapiens SEPTIN6 type I protein. 31 2.2 AF397023-1|AAN76547.1| 429|Homo sapiens septin 6 protein. 31 2.2 BC050345-1|AAH50345.2| 507|Homo sapiens SEPT10 protein protein. 31 3.8 BC020502-1|AAH20502.1| 454|Homo sapiens septin 10 protein. 31 3.8 AK021681-1|BAB13873.1| 454|Homo sapiens protein ( Homo sapiens ... 31 3.8 AF146760-1|AAF67469.1| 517|Homo sapiens septin 10 protein. 31 3.8 AC140485-1|AAY24142.1| 454|Homo sapiens unknown protein. 31 3.8 BC063615-1|AAH63615.1| 429|Homo sapiens septin 11 protein. 30 6.7 BC008083-1|AAH08083.3| 429|Homo sapiens septin 11 protein. 30 6.7 AK001711-1|BAA91853.1| 429|Homo sapiens protein ( Homo sapiens ... 30 6.7 AC104687-1|AAY40922.1| 317|Homo sapiens unknown protein. 30 6.7 >Y11593-1|CAA72332.1| 369|Homo sapiens putative septin protein. Length = 369 Score = 57.6 bits (133), Expect = 3e-08 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = +1 Query: 442 LKESGKMTMERDRGERD--YIGFATLPEQVHRKSVKRGFDFTLMV 570 L+ K+ D+ + D Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 5 LRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMV 49 >U74628-1|AAB93438.1| 369|Homo sapiens cell division control related protein protein. Length = 369 Score = 57.6 bits (133), Expect = 3e-08 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = +1 Query: 442 LKESGKMTMERDRGERD--YIGFATLPEQVHRKSVKRGFDFTLMV 570 L+ K+ D+ + D Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 5 LRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMV 49 >CR456545-1|CAG30431.1| 369|Homo sapiens PNUTL1 protein. Length = 369 Score = 57.6 bits (133), Expect = 3e-08 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = +1 Query: 442 LKESGKMTMERDRGERD--YIGFATLPEQVHRKSVKRGFDFTLMV 570 L+ K+ D+ + D Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 5 LRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMV 49 >BC025261-1|AAH25261.1| 369|Homo sapiens septin 5 protein. Length = 369 Score = 57.6 bits (133), Expect = 3e-08 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = +1 Query: 442 LKESGKMTMERDRGERD--YIGFATLPEQVHRKSVKRGFDFTLMV 570 L+ K+ D+ + D Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 5 LRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMV 49 >AF006988-1|AAC39779.1| 369|Homo sapiens septin protein. Length = 369 Score = 57.6 bits (133), Expect = 3e-08 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = +1 Query: 442 LKESGKMTMERDRGERD--YIGFATLPEQVHRKSVKRGFDFTLMV 570 L+ K+ D+ + D Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 5 LRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMV 49 >U88870-1|AAD00657.1| 459|Homo sapiens cell division control-related protein 2b protein. Length = 459 Score = 57.2 bits (132), Expect = 4e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 102 DKEYVGFATLPNQVHRKSVKKGFDFTLMV 130 >U88829-1|AAD00653.1| 478|Homo sapiens cell division control-related 2a protein protein. Length = 478 Score = 57.2 bits (132), Expect = 4e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 121 DKEYVGFATLPNQVHRKSVKKGFDFTLMV 149 >U59632-1|AAB93436.1| 385|Homo sapiens H5 protein. Length = 385 Score = 57.2 bits (132), Expect = 4e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 463 TMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 T+ RD ++ Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 31 TIPRDI-DKQYVGFATLPNQVHRKSVKKGFDFTLMV 65 >D89278-1|BAB46922.1| 478|Homo sapiens cerebral protein-7 protein. Length = 478 Score = 57.2 bits (132), Expect = 4e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 121 DKEYVGFATLPNQVHRKSVKKGFDFTLMV 149 >CR457111-1|CAG33392.1| 478|Homo sapiens PNUTL2 protein. Length = 478 Score = 57.2 bits (132), Expect = 4e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 121 DKEYVGFATLPNQVHRKSVKKGFDFTLMV 149 >BC018056-1|AAH18056.3| 459|Homo sapiens septin 4 protein. Length = 459 Score = 57.2 bits (132), Expect = 4e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 102 DKEYVGFATLPNQVHRKSVKKGFDFTLMV 130 >AF176379-1|AAG45673.1| 274|Homo sapiens ARTS protein protein. Length = 274 Score = 57.2 bits (132), Expect = 4e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 102 DKEYVGFATLPNQVHRKSVKKGFDFTLMV 130 >AF073312-1|AAC25673.1| 478|Homo sapiens peanut-like 2 protein. Length = 478 Score = 57.2 bits (132), Expect = 4e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 121 DKEYVGFATLPNQVHRKSVKKGFDFTLMV 149 >AF035811-1|AAB88512.1| 478|Homo sapiens protein H5 protein. Length = 478 Score = 57.2 bits (132), Expect = 4e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 121 DKEYVGFATLPNQVHRKSVKKGFDFTLMV 149 >AF006988-2|AAC39780.1| 417|Homo sapiens septin protein. Length = 417 Score = 57.2 bits (132), Expect = 4e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 463 TMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 T+ RD ++ Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 63 TIPRDI-DKQYVGFATLPNQVHRKSVKKGFDFTLMV 97 >AB008753-1|BAB70695.1| 478|Homo sapiens Bradeion beta protein. Length = 478 Score = 57.2 bits (132), Expect = 4e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 121 DKEYVGFATLPNQVHRKSVKKGFDFTLMV 149 >AK056273-1|BAB71133.1| 346|Homo sapiens protein ( Homo sapiens cDNA FLJ31711 fis, clone NT2RI2006412, highly similar to Rattus norvegicus mRNA for CDCrel-1A. ). Length = 346 Score = 56.4 bits (130), Expect = 7e-08 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 ++ Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 30 DKQYVGFATLPNQVHRKSVKKGFDFTLMV 58 >AF061153-1|AAC25957.1| 336|Homo sapiens MLL/hCDCrel fusion protein protein. Length = 336 Score = 56.4 bits (130), Expect = 7e-08 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 ++ Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 142 DKQYVGFATLPNQVHRKSVKKGFDFTLMV 170 >AF061152-1|AAC25956.1| 336|Homo sapiens MLL/hCDCrel fusion protein protein. Length = 336 Score = 56.4 bits (130), Expect = 7e-08 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 ++ Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 142 DKQYVGFATLPNQVHRKSVKKGFDFTLMV 170 >AB209168-1|BAD92405.1| 394|Homo sapiens H5 variant protein. Length = 394 Score = 56.4 bits (130), Expect = 7e-08 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 ++ Y+GFATLP QVHRKSVK+GFDFTLMV Sbjct: 46 DKQYVGFATLPNQVHRKSVKKGFDFTLMV 74 >BC107718-1|AAI07719.1| 235|Homo sapiens SEPT7 protein protein. Length = 235 Score = 54.8 bits (126), Expect = 2e-07 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +1 Query: 463 TMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 TM + + Y+GFA LP QV+RKSVKRGF+FTLMVV Sbjct: 19 TMAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVV 55 >BC012161-1|AAH12161.1| 367|Homo sapiens septin 1 protein. Length = 367 Score = 54.0 bits (124), Expect = 4e-07 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFA LP Q+HRKSVK+GFDFTLMV Sbjct: 2 DKEYVGFAALPNQLHRKSVKKGFDFTLMV 30 >AY034176-1|AAK61491.1| 372|Homo sapiens septin 1 protein. Length = 372 Score = 54.0 bits (124), Expect = 4e-07 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFA LP Q+HRKSVK+GFDFTLMV Sbjct: 7 DKEYVGFAALPNQLHRKSVKKGFDFTLMV 35 >AF085235-1|AAL40393.1| 366|Homo sapiens LARP protein. Length = 366 Score = 54.0 bits (124), Expect = 4e-07 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGFDFTLMV 570 +++Y+GFA LP Q+HRKSVK+GFDFTLMV Sbjct: 2 DKEYVGFAALPNQLHRKSVKKGFDFTLMV 30 >D63878-1|BAA09928.2| 367|Homo sapiens KIAA0158 protein. Length = 367 Score = 52.8 bits (121), Expect = 8e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QVHRKSVK+GF+FTLMVV Sbjct: 23 YVGFANLPNQVHRKSVKKGFEFTLMVV 49 >D28540-1|BAA05893.1| 406|Homo sapiens Human Diff6,H5,CDC10 homologue protein. Length = 406 Score = 52.8 bits (121), Expect = 8e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QVHRKSVK+GF+FTLMVV Sbjct: 17 YVGFANLPNQVHRKSVKKGFEFTLMVV 43 >DQ232879-1|ABB17294.1| 417|Homo sapiens septin 7 protein. Length = 417 Score = 52.8 bits (121), Expect = 8e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 466 MERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 M + + Y+GFA LP QV+RKSVKRGF+FTLMVV Sbjct: 1 MAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVV 36 >BC067264-1|AAH67264.2| 417|Homo sapiens septin 7 protein. Length = 417 Score = 52.8 bits (121), Expect = 8e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 466 MERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 M + + Y+GFA LP QV+RKSVKRGF+FTLMVV Sbjct: 1 MAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVV 36 >BC033559-1|AAH33559.1| 371|Homo sapiens SEPT2 protein protein. Length = 371 Score = 52.8 bits (121), Expect = 8e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QVHRKSVK+GF+FTLMVV Sbjct: 17 YVGFANLPNQVHRKSVKKGFEFTLMVV 43 >BC025987-1|AAH25987.3| 417|Homo sapiens septin 7 protein. Length = 417 Score = 52.8 bits (121), Expect = 8e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 466 MERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 M + + Y+GFA LP QV+RKSVKRGF+FTLMVV Sbjct: 1 MAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVV 36 >BC014455-1|AAH14455.1| 361|Homo sapiens septin 2 protein. Length = 361 Score = 52.8 bits (121), Expect = 8e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QVHRKSVK+GF+FTLMVV Sbjct: 17 YVGFANLPNQVHRKSVKKGFEFTLMVV 43 >AF038404-1|AAB92377.1| 361|Homo sapiens homolog of Nedd5 protein. Length = 361 Score = 52.8 bits (121), Expect = 8e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QVHRKSVK+GF+FTLMVV Sbjct: 17 YVGFANLPNQVHRKSVKKGFEFTLMVV 43 >AC104841-1|AAY14718.1| 318|Homo sapiens unknown protein. Length = 318 Score = 52.8 bits (121), Expect = 8e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QVHRKSVK+GF+FTLMVV Sbjct: 17 YVGFANLPNQVHRKSVKKGFEFTLMVV 43 >S72008-1|AAB31337.1| 418|Homo sapiens hCDC10 protein. Length = 418 Score = 51.6 bits (118), Expect = 2e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QV+RKSVKRGF+FTLMVV Sbjct: 11 YVGFANLPNQVYRKSVKRGFEFTLMVV 37 >BC093642-1|AAH93642.2| 418|Homo sapiens septin 7 protein. Length = 418 Score = 51.6 bits (118), Expect = 2e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QV+RKSVKRGF+FTLMVV Sbjct: 11 YVGFANLPNQVYRKSVKRGFEFTLMVV 37 >BC093640-1|AAH93640.2| 418|Homo sapiens septin 7 protein. Length = 418 Score = 51.6 bits (118), Expect = 2e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QV+RKSVKRGF+FTLMVV Sbjct: 11 YVGFANLPNQVYRKSVKRGFEFTLMVV 37 >AB209677-1|BAD92914.1| 381|Homo sapiens CDC10 protein variant protein. Length = 381 Score = 51.6 bits (118), Expect = 2e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QV+RKSVKRGF+FTLMVV Sbjct: 16 YVGFANLPNQVYRKSVKRGFEFTLMVV 42 >AB073389-1|BAE45719.1| 418|Homo sapiens predicted protein product of Nbla02942 protein. Length = 418 Score = 51.6 bits (118), Expect = 2e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 Y+GFA LP QV+RKSVKRGF+FTLMVV Sbjct: 11 YVGFANLPNQVYRKSVKRGFEFTLMVV 37 >AF061154-1|AAC25958.1| 82|Homo sapiens MLL/hCDCrel fusion protein protein. Length = 82 Score = 44.4 bits (100), Expect = 3e-04 Identities = 17/23 (73%), Positives = 21/23 (91%) Frame = +1 Query: 484 ERDYIGFATLPEQVHRKSVKRGF 552 ++ Y+GFATLP QVHRKSVK+GF Sbjct: 60 DKQYVGFATLPNQVHRKSVKKGF 82 >U85431-1|AAD00564.1| 150|Homo sapiens unknown protein protein. Length = 150 Score = 41.5 bits (93), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 511 LPEQVHRKSVKRGFDFTLMV 570 +P QVHRKSVK+GFDFTLMV Sbjct: 1 MPNQVHRKSVKKGFDFTLMV 20 >Z99716-6|CAI41693.1| 350|Homo sapiens septin 3 protein. Length = 350 Score = 37.1 bits (82), Expect = 0.044 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 YIG T+ EQ+ +K++K GFDF +MVV Sbjct: 41 YIGIDTIIEQMRKKTMKTGFDFNIMVV 67 >CR456572-1|CAG30458.1| 350|Homo sapiens SEPT3 protein. Length = 350 Score = 37.1 bits (82), Expect = 0.044 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 YIG T+ EQ+ +K++K GFDF +MVV Sbjct: 41 YIGIDTIIEQMRKKTMKTGFDFNIMVV 67 >BC111779-1|AAI11780.2| 345|Homo sapiens septin 3 protein. Length = 345 Score = 37.1 bits (82), Expect = 0.044 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 YIG T+ EQ+ +K++K GFDF +MVV Sbjct: 28 YIGIDTIIEQMRKKTMKTGFDFNIMVV 54 >AF285109-1|AAG00519.1| 337|Homo sapiens septin 3 isoform B protein. Length = 337 Score = 37.1 bits (82), Expect = 0.044 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 YIG T+ EQ+ +K++K GFDF +MVV Sbjct: 28 YIGIDTIIEQMRKKTMKTGFDFNIMVV 54 >AF285108-1|AAG00518.1| 70|Homo sapiens septin 3 isoform C protein. Length = 70 Score = 37.1 bits (82), Expect = 0.044 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 YIG T+ EQ+ +K++K GFDF +MVV Sbjct: 28 YIGIDTIIEQMRKKTMKTGFDFNIMVV 54 >AF285107-1|AAG00517.1| 345|Homo sapiens septin 3 isoform A protein. Length = 345 Score = 37.1 bits (82), Expect = 0.044 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 YIG T+ EQ+ +K++K GFDF +MVV Sbjct: 28 YIGIDTIIEQMRKKTMKTGFDFNIMVV 54 >BT007215-1|AAP35879.1| 568|Homo sapiens MLL septin-like fusion protein. Length = 568 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 243 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 286 >BC114550-1|AAI14551.1| 341|Homo sapiens SEPT9 protein protein. Length = 341 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 222 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 265 >BC054004-1|AAH54004.1| 422|Homo sapiens SEPT9 protein protein. Length = 422 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 97 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 140 >BC021192-1|AAH21192.1| 568|Homo sapiens septin 9 protein. Length = 568 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 243 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 286 >AK022493-1|BAB14057.1| 196|Homo sapiens protein ( Homo sapiens cDNA FLJ12431 fis, clone MAMMA1003166, highly similar to Homo sapiens MLL septin-like fusion protein (MSF) mRNA. ). Length = 196 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 10 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 53 >AJ312322-1|CAC42224.1| 422|Homo sapiens OVARIAN/Breast septin beta protein. Length = 422 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 97 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 140 >AJ312321-1|CAC42223.1| 568|Homo sapiens OVARIAN/Breast septin alpha protein. Length = 568 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 243 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 286 >AJ312320-1|CAC42222.1| 335|Homo sapiens OVARIAN/Breast septin delta protein. Length = 335 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 10 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 53 >AJ312319-1|CAC42221.1| 579|Homo sapiens OVARIAN/Breast septin gamma protein. Length = 579 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 254 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 297 >AF189713-1|AAF23374.1| 586|Homo sapiens MLL septin-like fusion protein MSF-A protein. Length = 586 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 261 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 304 >AF189712-1|AAF23373.1| 422|Homo sapiens MLL septin-like fusion protein MSF-B protein. Length = 422 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 97 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 140 >AF142408-1|AAG27919.1| 568|Homo sapiens cell division control protein septin D1 protein. Length = 568 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 243 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 286 >AF123052-1|AAD39749.1| 568|Homo sapiens MLL septin-like fusion protein protein. Length = 568 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 243 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 286 >AB023208-1|BAA76835.2| 630|Homo sapiens KIAA0991 protein protein. Length = 630 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +1 Query: 442 LKESGKMTMERDRGERDYIGFATLPEQVHRKSVKRGFDFTLMVV 573 LK++ E+ + Y+G ++ EQ+ RK++K+GF+F +MVV Sbjct: 305 LKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV 348 >D86957-1|BAA13193.1| 508|Homo sapiens KIAA0202 protein. Length = 508 Score = 31.9 bits (69), Expect = 1.7 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 103 HVGFDSLPDQLVSKSVTQGFSFNILCV 129 >AF440763-1|AAO13880.1| 453|Homo sapiens septin SEPT8_v3 protein. Length = 453 Score = 31.9 bits (69), Expect = 1.7 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 48 HVGFDSLPDQLVSKSVTQGFSFNILCV 74 >AF440762-1|AAO13879.1| 562|Homo sapiens septin SEPT8_v2 protein. Length = 562 Score = 31.9 bits (69), Expect = 1.7 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 103 HVGFDSLPDQLVSKSVTQGFSFNILCV 129 >AF440761-1|AAO13878.1| 508|Homo sapiens septin SEPT8_v1* protein. Length = 508 Score = 31.9 bits (69), Expect = 1.7 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 103 HVGFDSLPDQLVSKSVTQGFSFNILCV 129 >AF179995-1|AAG09407.1| 508|Homo sapiens septin 2 protein. Length = 508 Score = 31.9 bits (69), Expect = 1.7 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 103 HVGFDSLPDQLVSKSVTQGFSFNILCV 129 >D50918-1|BAA09477.1| 424|Homo sapiens KIAA0128 protein. Length = 424 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 19 HVGFDSLPDQLVNKSVSQGFCFNILCV 45 >BC069231-1|AAH69231.1| 427|Homo sapiens septin 6 protein. Length = 427 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >BC036240-1|AAH36240.1| 434|Homo sapiens septin 6 protein. Length = 434 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >BC011922-1|AAH11922.3| 429|Homo sapiens septin 6 protein. Length = 429 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >BC009291-1|AAH09291.1| 434|Homo sapiens septin 6 protein. Length = 434 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AY679521-1|AAT80339.1| 438|Homo sapiens septin 6 isoform E protein. Length = 438 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AY034177-1|AAK61492.1| 427|Homo sapiens septin 6 protein. Length = 427 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AY005981-1|AAF97496.1| 427|Homo sapiens septin 6 protein. Length = 427 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AL355348-4|CAI41428.1| 427|Homo sapiens septin 6 protein. Length = 427 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AL355348-3|CAI41427.1| 431|Homo sapiens septin 6 protein. Length = 431 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AL355348-2|CAI41426.1| 434|Homo sapiens septin 6 protein. Length = 434 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AL355348-1|CAI41425.1| 429|Homo sapiens septin 6 protein. Length = 429 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AF512946-1|AAM82548.1| 559|Homo sapiens MLL/SEPTIN6 fusion protein protein. Length = 559 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 154 HVGFDSLPDQLVNKSVSQGFCFNILCV 180 >AF512945-1|AAM82547.1| 496|Homo sapiens MLL/SEPTIN6 fusion protein protein. Length = 496 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 154 HVGFDSLPDQLVNKSVSQGFCFNILCV 180 >AF512944-1|AAM82546.1| 265|Homo sapiens MLL/SEPTIN6 fusion protein protein. Length = 265 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 154 HVGFDSLPDQLVNKSVSQGFCFNILCV 180 >AF512943-1|AAM82545.1| 470|Homo sapiens MLL/SEPTIN6 fusion protein protein. Length = 470 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 154 HVGFDSLPDQLVNKSVSQGFCFNILCV 180 >AF403062-1|AAK98551.1| 429|Homo sapiens SEPTIN6 type V protein. Length = 429 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AF403061-1|AAK98550.1| 267|Homo sapiens SEPTIN6 type IV protein. Length = 267 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AF403060-1|AAK98549.1| 427|Homo sapiens SEPTIN6 type III protein. Length = 427 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AF403059-1|AAK98548.1| 434|Homo sapiens SEPTIN6 type II protein. Length = 434 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AF403058-1|AAK98547.1| 427|Homo sapiens SEPTIN6 type I protein. Length = 427 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >AF397023-1|AAN76547.1| 429|Homo sapiens septin 6 protein. Length = 429 Score = 31.5 bits (68), Expect = 2.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KSV +GF F ++ V Sbjct: 22 HVGFDSLPDQLVNKSVSQGFCFNILCV 48 >BC050345-1|AAH50345.2| 507|Homo sapiens SEPT10 protein protein. Length = 507 Score = 30.7 bits (66), Expect = 3.8 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ +S+++GF F ++ V Sbjct: 46 HVGFESLPDQLVNRSIQQGFCFNILCV 72 >BC020502-1|AAH20502.1| 454|Homo sapiens septin 10 protein. Length = 454 Score = 30.7 bits (66), Expect = 3.8 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ +S+++GF F ++ V Sbjct: 46 HVGFESLPDQLVNRSIQQGFCFNILCV 72 >AK021681-1|BAB13873.1| 454|Homo sapiens protein ( Homo sapiens cDNA FLJ11619 fis, clone HEMBA1004131, moderately similar to SEPTIN 2 HOMOLOG. ). Length = 454 Score = 30.7 bits (66), Expect = 3.8 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ +S+++GF F ++ V Sbjct: 46 HVGFESLPDQLVNRSIQQGFCFNILCV 72 >AF146760-1|AAF67469.1| 517|Homo sapiens septin 10 protein. Length = 517 Score = 30.7 bits (66), Expect = 3.8 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ +S+++GF F ++ V Sbjct: 46 HVGFESLPDQLVNRSIQQGFCFNILCV 72 >AC140485-1|AAY24142.1| 454|Homo sapiens unknown protein. Length = 454 Score = 30.7 bits (66), Expect = 3.8 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ +S+++GF F ++ V Sbjct: 46 HVGFESLPDQLVNRSIQQGFCFNILCV 72 >BC063615-1|AAH63615.1| 429|Homo sapiens septin 11 protein. Length = 429 Score = 29.9 bits (64), Expect = 6.7 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KS +GF F ++ V Sbjct: 21 HVGFDSLPDQLVNKSTSQGFCFNILCV 47 >BC008083-1|AAH08083.3| 429|Homo sapiens septin 11 protein. Length = 429 Score = 29.9 bits (64), Expect = 6.7 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KS +GF F ++ V Sbjct: 21 HVGFDSLPDQLVNKSTSQGFCFNILCV 47 >AK001711-1|BAA91853.1| 429|Homo sapiens protein ( Homo sapiens cDNA FLJ10849 fis, clone NT2RP4001414, highly similar to SEPTIN 2 HOMOLOG. ). Length = 429 Score = 29.9 bits (64), Expect = 6.7 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KS +GF F ++ V Sbjct: 21 HVGFDSLPDQLVNKSTSQGFCFNILCV 47 >AC104687-1|AAY40922.1| 317|Homo sapiens unknown protein. Length = 317 Score = 29.9 bits (64), Expect = 6.7 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 493 YIGFATLPEQVHRKSVKRGFDFTLMVV 573 ++GF +LP+Q+ KS +GF F ++ V Sbjct: 21 HVGFDSLPDQLVNKSTSQGFCFNILCV 47 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,674,511 Number of Sequences: 237096 Number of extensions: 1157284 Number of successful extensions: 1668 Number of sequences better than 10.0: 96 Number of HSP's better than 10.0 without gapping: 1665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1668 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5929224630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -