BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m21r (794 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38742| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48525| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 66 4e-11 SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_25657| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 51 9e-07 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 50 3e-06 SB_36880| Best HMM Match : DUF1337 (HMM E-Value=0.54) 31 0.81 SB_37668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_35094| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_5404| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_39069| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_9335| Best HMM Match : 7tm_1 (HMM E-Value=8.1e-05) 29 4.3 SB_58481| Best HMM Match : MAM33 (HMM E-Value=4.7) 29 4.3 >SB_38742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 70.9 bits (166), Expect = 1e-12 Identities = 49/157 (31%), Positives = 70/157 (44%) Frame = -2 Query: 655 AVTYWLTSGAPSQKIVLSIATFGRTWKLDADSEIAGVPPIHTDGPGEAGPYVKTEGLLSY 476 AV W+ G PS KI L I +GR++ L ++ P G GPY K G ++Y Sbjct: 241 AVDLWIAGGMPSNKIALGIPLYGRSFTLKTANKTLDAPATK----GGQGPYTKEAGYIAY 296 Query: 475 PEVCGKLINPNQQKGMRPHLRKVTDPSKRFGTYAFRLPDDNGEGGIWVSYEDPDTAGQKA 296 E+C + G+ VT Y D N + WV Y+D + +K Sbjct: 297 FEIC--------KMGL-----SVTRDPVLVSPYGV---DVNNQ---WVGYDDVTSVQEKV 337 Query: 295 AYVKSKNLGGVAIVDLSLDDFRGLCTGDKYPILRAAK 185 Y+K K+L G + LDDF+G C YP++ A K Sbjct: 338 NYIKKKSLLGAMFWAMDLDDFKGDCGQGSYPLMTAVK 374 >SB_48525| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 569 Score = 65.7 bits (153), Expect = 4e-11 Identities = 48/159 (30%), Positives = 74/159 (46%), Gaps = 2/159 (1%) Frame = -2 Query: 655 AVTYWLTSGAPSQKIVLSIATFGRTWKLDADSEIAGVPPIHTDGPGEAGPYVKTEGLLSY 476 A YW+ GAP+ KI L + T+GR +KL AD G+ +G G Y + G L+Y Sbjct: 354 AAQYWIDKGAPASKIALGLGTYGRAFKL-ADQTRHGL-KAPANGNPTRGQYTREPGFLAY 411 Query: 475 PEVCGKLINPNQQKGMRPHLRKVTDPSKRFGTYAFRLPDDNGEGGIWVSYEDPDTAGQKA 296 E+C + +L+ + S A + P + G +WV Y+D + K Sbjct: 412 YEIC------------KMNLQVTSTESS-----AVKAPYGH-VGDLWVGYDDEYSLSLKV 453 Query: 295 -AYVKSKNLGGVAIVDLSLDDFRG-LCTGDKYPILRAAK 185 +K+K + G + LDDF+G C YP++ A K Sbjct: 454 ERVIKAKGMAGAMFWAIPLDDFKGQFCGKGPYPLINAVK 492 >SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 807 Score = 58.0 bits (134), Expect = 8e-09 Identities = 48/161 (29%), Positives = 74/161 (45%), Gaps = 1/161 (0%) Frame = -2 Query: 655 AVTYWLTSGAPSQKIVLSIATFGRTWKLDADSEIAGVPPIHTDGPGEAGPYVKTEGLLSY 476 AV YW+ G P KI L +A +G ++L ++ A P + + G + PY Sbjct: 623 AVKYWMEKGMPCGKIALGMANYGHAFELSDPTKTALGAPANVN-KGRSYPYY-------- 673 Query: 475 PEVCGKLINPNQQKGMRPHLRKVTD-PSKRFGTYAFRLPDDNGEGGIWVSYEDPDTAGQK 299 E+C KL L KVTD P+K Y + G W++Y+D + G+K Sbjct: 674 -ELC-KL-----------PLTKVTDNPAK--APYGYH-------GSQWIAYDDVTSLGRK 711 Query: 298 AAYVKSKNLGGVAIVDLSLDDFRGLCTGDKYPILRAAKYRL 176 +K +NL G + LDDF +C +P++ A +Y L Sbjct: 712 VELIKKENLLGAMFWAIDLDDFGNVCGQGAHPLMGAVRYML 752 >SB_25657| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 829 Score = 51.2 bits (117), Expect = 9e-07 Identities = 54/180 (30%), Positives = 79/180 (43%), Gaps = 2/180 (1%) Frame = -2 Query: 703 LFTPHKIATPLQNADAAVTYWLTSGAPSQKIVLSIATFGRTWKLDADSEIAGVPPIHTDG 524 L P I + N D + +G P+ KIVL + T+GR + L E AG + Sbjct: 624 LTLPFAIWYWMNNRDTWEKPGIRNGMPANKIVLGLGTYGRAFGL----ESAG------NN 673 Query: 523 PGEAGPYVKTEGLLSYPEVCGKLINPNQQKGMRPHLRKVTDPSKRFGTYAFRLPDDNGEG 344 +AG Y +G L+Y E+C + G+ V + +K Y ++ G Sbjct: 674 GLDAGKYTGAKGFLAYFEIC--------KMGL-----TVVENNKAKAPYGYK-------G 713 Query: 343 GIWVSYEDPDTAGQKAAYVKSKN-LGGVAIVDLSLDDFRG-LCTGDKYPILRAAKYRL*N 170 WV +++P + K V KN L GV + LDDF G C KYP++ A K L N Sbjct: 714 HDWVGFDNPKSLIYKIDNVVKKNQLRGVMFWAIDLDDFSGEHCGQGKYPLMSAVKNYLTN 773 Score = 42.3 bits (95), Expect = 4e-04 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 2/112 (1%) Frame = -2 Query: 514 AGPYVKTEGLLSYPEVCGKLINPNQQKGMRPHLRKVTDPSKRFGTYAFRLPDDNGEGGIW 335 +G Y EG L+Y E+C ++G+ V +K Y ++ D W Sbjct: 280 SGKYTDAEGFLAYYEIC--------KRGLT-----VVHKNKANAPYGYKGKD-------W 319 Query: 334 VSYEDPDTAGQKAAYVKSKN-LGGVAIVDLSLDDFRG-LCTGDKYPILRAAK 185 + ++DP++ K V KN L GV + LDDF G C KYP++ A K Sbjct: 320 IGFDDPNSLVYKIDNVVKKNQLRGVMFWAIDLDDFSGEHCGQGKYPLMSAVK 371 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 49.6 bits (113), Expect = 3e-06 Identities = 37/117 (31%), Positives = 52/117 (44%), Gaps = 2/117 (1%) Frame = -2 Query: 529 DGPGEAGPYVKTEGLLSYPEVCGKLINPNQQKGMRPHLRKVTDPSKRFGTYAFRLPDDNG 350 +G GPY + G LSY E+C + + K M+ TD S+ Y + D Sbjct: 10 NGNPPRGPYTRESGFLSYYEICDMM---PKMKTMK------TDQSEVRAPYGYVKQD--- 57 Query: 349 EGGIWVSYEDPDTAGQKA-AYVKSKNLGGVAIVDLSLDDFRG-LCTGDKYPILRAAK 185 +WV Y+D + K +K+K L G L LDDF G C YP++ A K Sbjct: 58 WADVWVGYDDERSLQLKVEEVIKAKGLAGAMFWALDLDDFDGSSCGKGNYPLMNAVK 114 >SB_36880| Best HMM Match : DUF1337 (HMM E-Value=0.54) Length = 367 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +3 Query: 195 LRIGYLSPVQRPRKSSNDR-STIATPPRFFDLT*AAFWPAVSGSSYDTQMPPSPLSSGRR 371 L+I L ++ KS++DR TI P F D + A V+G ++MPP G++ Sbjct: 27 LKIAVLRKHRKTTKSTDDRCGTINRWPTFLDNSFAFIAAEVNGLESCSKMPPKKKGKGKK 86 Query: 372 K 374 K Sbjct: 87 K 87 >SB_37668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 379 YAFRLPDDNGEGGIWVSYEDPDTAGQKAAYVKSKNLGGVAI 257 + ++ PD + +G V+YEDP TA + K+ G +I Sbjct: 208 WIYKHPDGSSKGECTVTYEDPPTASAAIEWFNGKDFMGQSI 248 >SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1845 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 747 LHSDTQQQRS*LHSSYLHPTKSQPHCRTPTPLSHTGSRAV 628 LHSDT Q++ + +P H +P SH+G++ V Sbjct: 158 LHSDTHQEKYNTWNKQHNPVSELQHIENLSPSSHSGAKKV 197 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/72 (31%), Positives = 33/72 (45%) Frame = -1 Query: 728 NKEADYTAPIYTPQNRNPTAERRRRCHILAHERCSKPKDSIVYRDLRSYLETGR*QRNCG 549 +KE+ +P+ R ++RRR H AH R S+ + R + R +R Sbjct: 188 HKESPVHHRSLSPEPRRGYRDQRRRSHSPAHHRRSRSRSRSRSPRRRRRSRSPRRRRRSR 247 Query: 548 SPSNPH*WSRRS 513 SPS PH S RS Sbjct: 248 SPS-PHHRSHRS 258 >SB_35094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 711 HSSYLHPTKSQPHCRTPTPLSHTGSRA 631 H+ Y H K + H R TP +HT +RA Sbjct: 87 HAEYTHAYKRRAHPRLHTPTTHTPTRA 113 >SB_5404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 711 HSSYLHPTKSQPHCRTPTPLSHTGSRA 631 H+ Y H K + H R TP +HT +RA Sbjct: 87 HAEYTHAYKRRAHPRLHTPTTHTPTRA 113 >SB_39069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 5/72 (6%) Frame = -1 Query: 782 LVDYVNVGAYDYYTPTRN-NKEADYTAPIYTPQNRNPTAERRRRCHILAHER----CSKP 618 L +V DY+ P N N+ A +T P+ T + +R R H LA+++ + Sbjct: 103 LTSVESVDHEDYFLPRDNKNRSASFT-PLSTVKKDEEAIAQRPRSHTLANDKDISLYREQ 161 Query: 617 KDSIVYRDLRSY 582 KD ++ + +R Y Sbjct: 162 KDRLIKQLMREY 173 >SB_9335| Best HMM Match : 7tm_1 (HMM E-Value=8.1e-05) Length = 226 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/59 (28%), Positives = 31/59 (52%) Frame = -3 Query: 363 LMTTVRVAFGYHTRILILLARKLLTSSQRISVVSLLWTYHWMTSAVSVPETSIQSLGPL 187 ++T + + F + I RKL + + S++ LLW + WMT +V E ++S P+ Sbjct: 106 IVTLLLICFDRYESIRNPFRRKLNFTKAQKSLL-LLWIFAWMTFSVPFIEHGLRSTTPV 163 >SB_58481| Best HMM Match : MAM33 (HMM E-Value=4.7) Length = 233 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 5/72 (6%) Frame = -1 Query: 782 LVDYVNVGAYDYYTPTRN-NKEADYTAPIYTPQNRNPTAERRRRCHILAHER----CSKP 618 L +V DY+ P N N+ A +T P+ T + +R R H LA+++ + Sbjct: 104 LTSVESVDHEDYFLPRDNKNRSASFT-PLSTVKKDEEAIAQRPRSHTLANDKDISLYREQ 162 Query: 617 KDSIVYRDLRSY 582 KD ++ + +R Y Sbjct: 163 KDRLIKQLMREY 174 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,393,004 Number of Sequences: 59808 Number of extensions: 591414 Number of successful extensions: 1755 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1749 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -