BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m21r (794 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 24 1.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 3.3 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 7.5 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 21 10.0 AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 21 10.0 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.8 bits (49), Expect = 1.9 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 9/50 (18%) Frame = -2 Query: 607 LSIATFGRTWKLDADSEIAGVP---------PIHTDGPGEAGPYVKTEGL 485 LSI + G W++ SE +P P+H G GP V G+ Sbjct: 33 LSIYSGGSDWRVAGRSESVVIPGDIVLGGLFPVHEKGGASCGPNVYNRGV 82 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.0 bits (47), Expect = 3.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 696 HPTKSQPHCRTPTPLSHTGSRAVLQ 622 H + PH + TPL+H+ A +Q Sbjct: 434 HSHAATPHHQHSTPLAHSSYPAAIQ 458 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 7.5 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = +2 Query: 689 VGCK*ELCNQLLCCCVSE 742 +GC+ + CN CC ++ Sbjct: 433 IGCECKTCNSKTKCCFAQ 450 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 21.4 bits (43), Expect = 10.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 668 ERRRRCHILAHERCSKPKDSIVYR 597 + R+ C +AH SK + SIV R Sbjct: 90 QNRKFCAEIAHGGSSKKRKSIVER 113 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 528 SVWIGGTPAISLS 566 SVWIGG+ SLS Sbjct: 113 SVWIGGSILASLS 125 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,169 Number of Sequences: 438 Number of extensions: 5400 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -