BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m21f (596 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 184 1e-48 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 184 2e-48 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 79 1e-16 AF026494-1|AAB81852.1| 113|Anopheles gambiae chitinase protein. 69 9e-14 AF026493-1|AAB81851.1| 112|Anopheles gambiae chitinase protein. 57 4e-10 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 3.2 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 3.2 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 5.7 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 5.7 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.5 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 7.5 DQ370047-1|ABD18608.1| 89|Anopheles gambiae putative secreted ... 23 9.9 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 23 9.9 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 9.9 AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 23 9.9 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 184 bits (449), Expect = 1e-48 Identities = 87/159 (54%), Positives = 112/159 (70%), Gaps = 3/159 (1%) Frame = +3 Query: 108 THSKVLCYYDSRSYVRESQARMLPLDLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDI 287 T KVLCYYD + +RE ++ D++ AL FCTHL+YGYAG+ +TY+L SLNE+LD+ Sbjct: 29 TGPKVLCYYDGSNALREGLGKVTVSDIELALPFCTHLMYGYAGVNAETYRLRSLNEDLDL 88 Query: 288 DRTHDNYRAITSLKAKYPGLTVLLSVGG--DADTEEP-EKYNLLLESQQARTAFINSGVL 458 D ++RA+T+LK +YPGL V LSVG D E+P EKY LLES +RTAF+NS Sbjct: 89 DSGKSHFRAVTTLKRRYPGLKVFLSVGNYRDLGEEKPFEKYLTLLESGGSRTAFVNSAYS 148 Query: 459 LAEQYGFDGIDLAWQFPRVKPKKIRSTWGSLWHGIKKTF 575 L + Y FDG+DLAWQFP+ KPK+IR G +WHG KK F Sbjct: 149 LLKTYEFDGLDLAWQFPQTKPKRIRGWTGKVWHGFKKLF 187 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 184 bits (448), Expect = 2e-48 Identities = 89/162 (54%), Positives = 109/162 (67%), Gaps = 1/162 (0%) Frame = +3 Query: 114 SKVLCYYDSRSYVRESQARMLPLDLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDR 293 SKVLCYYD+ +++ E ++ D+D AL FCTHL+YGYAGI +T K VS NLD+D Sbjct: 26 SKVLCYYDAANFLIEGLGKVSLADIDAALPFCTHLVYGYAGIDVETNKAVSRQPNLDLDT 85 Query: 294 THDNYRAITSLKAKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGVLLAEQY 473 NYR +T LK+KYP L VLL +GG +E KY LLES AR FINS L + Y Sbjct: 86 GKGNYRTVTQLKSKYPSLKVLLGLGGYKFSEPSIKYLTLLESGAARITFINSVYSLLKTY 145 Query: 474 GFDGIDLAWQFPRVKPKKIRSTWGSLWHGIKKTF-GTTPVDE 596 GFDG+DL WQFP KPKK+RST G +WHG KK F G + +DE Sbjct: 146 GFDGVDLEWQFPMNKPKKVRSTLGGVWHGFKKVFSGDSVLDE 187 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 78.6 bits (185), Expect = 1e-16 Identities = 44/132 (33%), Positives = 71/132 (53%), Gaps = 1/132 (0%) Frame = +3 Query: 117 KVLCYYDSRSYVRESQARMLPLDLDPALSFCTHLLYGYAGIQPD-TYKLVSLNENLDIDR 293 KV+CY + + R R +DP+L CTHL+YG+ GI D T +++ +L+ + Sbjct: 32 KVVCYVGTWAVYRPGNGRYDIEHIDPSL--CTHLMYGFFGINEDATVRIIDPYLDLEENW 89 Query: 294 THDNYRAITSLKAKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGVLLAEQY 473 + + LK PGL L ++GG E K++ + S + R FI+ V +++ Sbjct: 90 GRGHIKRFVGLKNVGPGLKTLAAIGGW--NEGSRKFSAMAASGELRKRFISDCVAFCQRH 147 Query: 474 GFDGIDLAWQFP 509 GFDGIDL W++P Sbjct: 148 GFDGIDLDWEYP 159 >AF026494-1|AAB81852.1| 113|Anopheles gambiae chitinase protein. Length = 113 Score = 69.3 bits (162), Expect = 9e-14 Identities = 40/119 (33%), Positives = 65/119 (54%) Frame = +3 Query: 144 SYVRESQARMLPLDLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITS 323 ++ R+ + LP D+D L CTH++YG+A + + + + DID Y + Sbjct: 2 AWYRQGNGKYLPEDIDSDL--CTHVVYGFAVLDREALTIKPHDSWADIDNRF--YERVVE 57 Query: 324 LKAKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGVLLAEQYGFDGIDLAW 500 LK K G V +++GG D+ +KY+ L+ S QAR FI + + ++Y FDG+DL W Sbjct: 58 LKKK--GKKVTVAIGGWNDSAG-DKYSRLVRSSQARKRFIENVMKFIDKYNFDGLDLDW 113 >AF026493-1|AAB81851.1| 112|Anopheles gambiae chitinase protein. Length = 112 Score = 57.2 bits (132), Expect = 4e-10 Identities = 33/98 (33%), Positives = 54/98 (55%) Frame = +3 Query: 207 CTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAKYPGLTVLLSVGGDADTE 386 CTH++YG+A + T + + + DID Y + + K K G+ V L++GG D+ Sbjct: 21 CTHIVYGFAVLDYSTLTIKTHDSWADIDNKF--YTRVVAAKEK--GVKVTLAIGGWNDSA 76 Query: 387 EPEKYNLLLESQQARTAFINSGVLLAEQYGFDGIDLAW 500 +KY+ L+ + AR F+ + E+YGFDG+D W Sbjct: 77 G-DKYSRLVRTS-ARAKFVEHVIGFLEKYGFDGLDFDW 112 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 24.2 bits (50), Expect = 3.2 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = -3 Query: 252 RCQAGYRHSRTASGCRTTERDRGPTAACGLEIL*HSSCCRSNKVLCCG 109 RC AS CR+T + CGL SC K CG Sbjct: 507 RCFRCLEMGHIASNCRSTADRQNLCIRCGLTGHKARSCQNEAKCALCG 554 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 24.2 bits (50), Expect = 3.2 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = +3 Query: 366 GGDADTEEPEKYNLLLESQQART 434 GG++D+ + E+ NL+ E++ AR+ Sbjct: 106 GGESDSNDDEEDNLIDENRYARS 128 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 5.7 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 9/61 (14%) Frame = -2 Query: 502 CQARSIPSKPYC-----SANSTPELMKA----VRACCDSSRRLYFSGSSVSASPPTDNNT 350 C +S PS P+ S ST + A V AC ++ SG+S ++SP D + Sbjct: 7 CSPQSAPSPPHHHHSSQSPTSTTTVTMATASPVPACTTTTSTTSTSGASAASSPTRDEMS 66 Query: 349 V 347 V Sbjct: 67 V 67 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 5.7 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 9/61 (14%) Frame = -2 Query: 502 CQARSIPSKPYC-----SANSTPELMKA----VRACCDSSRRLYFSGSSVSASPPTDNNT 350 C +S PS P+ S ST + A V AC ++ SG+S ++SP D + Sbjct: 7 CSPQSAPSPPHHHHSSQSPTSTTTVTMATASPVPACTTTTSTTSTSGASAASSPTRDEMS 66 Query: 349 V 347 V Sbjct: 67 V 67 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 336 TWLSSW*SHGSCRV 295 +WLSS+ S+ SCRV Sbjct: 643 SWLSSYLSNRSCRV 656 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 23.0 bits (47), Expect = 7.5 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +1 Query: 130 TTTAGAMSENLKPACCRWTSIPLCRSAPTCCTAMPVSSLTPISWC 264 T G MSE+ P L R +P+ PV P WC Sbjct: 270 TPPPGYMSEDGDPLDQNDNMTDLSRMSPSEMDTQPVMYHEPTFWC 314 >DQ370047-1|ABD18608.1| 89|Anopheles gambiae putative secreted peptide protein. Length = 89 Score = 22.6 bits (46), Expect = 9.9 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 Query: 553 QSDPQVERIFLGLTLGNCQARSIPSKPYCS 464 Q DP E NCQ IP K +C+ Sbjct: 27 QCDPIYEEFTDDGCDDNCQGSCIPMKDFCA 56 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 22.6 bits (46), Expect = 9.9 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +1 Query: 454 CCWLNNMVSMELTSPGSSQELS----LRRSARPGDRFGMELRRHSAPRQSM 594 C L V M + G+ + L+ P D MELRRH R+ + Sbjct: 183 CPVLQTFVCMRCKATGTKAHTAKYCPLKPVITPEDCLAMELRRHKIHRKGV 233 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 22.6 bits (46), Expect = 9.9 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +1 Query: 454 CCWLNNMVSMELTSPGSSQELS----LRRSARPGDRFGMELRRHSAPRQSM 594 C L V M + G+ + L+ P D MELRRH R+ + Sbjct: 184 CPVLQTFVCMRCKATGTKAHTAKYCPLKPVITPEDCLAMELRRHKIHRKGV 234 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 22.6 bits (46), Expect = 9.9 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 115 AKYFVTTTAGAMSENLKPACCRWTSIP-LCRSAPTCC 222 A+YFVT A A + N C + +P L +A CC Sbjct: 95 ARYFVTDPADAYNVNRTETCLQ--ELPALELNAEKCC 129 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,110 Number of Sequences: 2352 Number of extensions: 12836 Number of successful extensions: 40 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -