BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m19r (741 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 31 0.049 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 28 0.35 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 25 1.9 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 4.3 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 7.5 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 7.5 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 7.5 Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase pr... 23 9.9 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 23 9.9 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 23 9.9 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 30.7 bits (66), Expect = 0.049 Identities = 26/113 (23%), Positives = 44/113 (38%) Frame = -2 Query: 641 RGYQGSREASDRKRQEEHHGLRLPVMDKGWKGNRQILLPHPV*SDLHRADCQAHKQKGPS 462 RG QG ++ R++Q++H + + +Q + Q +Q+ Sbjct: 212 RGRQGPQQQEQRQQQQQHQQREQQQQQQQQQQQQQQQQQQQQRNQQREWQQQQQQQQHQQ 271 Query: 461 RPQVDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQQSILQDHVHRRQTVPE 303 R Q + QQN QRQ QQ+ + +QQ + V RRQ + Sbjct: 272 REQQQQQRVQQQNQQH--QRQQQQQQQQRQQQQQQEQQELWTTVVRRRQNTQQ 322 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 27.9 bits (59), Expect = 0.35 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -2 Query: 488 QAHKQKGPSRPQVDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQ-QSIL 339 Q +Q+ RPQ RP + + R QR+ + L+EV P G+ +S+L Sbjct: 463 QQPQQQQQQRPQQQRPQQQRPQQQRSQQRKPAKPELIEVSPNEGQDWESLL 513 Score = 25.4 bits (53), Expect = 1.9 Identities = 24/106 (22%), Positives = 41/106 (38%) Frame = -2 Query: 632 QGSREASDRKRQEEHHGLRLPVMDKGWKGNRQILLPHPV*SDLHRADCQAHKQKGPSRPQ 453 QG R + RQ+ R + + +Q V L + Q Q+ + Q Sbjct: 260 QGERYVPPQLRQQRQQQQRPRQQQQQQQQQQQQQGERYVPPQLRQQRQQQQHQQQQQQQQ 319 Query: 452 VDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQQSILQDHVHRRQ 315 R + +Q + QRQ QQ+ + + +QQ Q H++Q Sbjct: 320 QQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQ 365 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 25.4 bits (53), Expect = 1.9 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 144 MKIWPPTKTVKPWG 103 M+++PPTK V P+G Sbjct: 315 MRVYPPTKIVTPYG 328 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.2 bits (50), Expect = 4.3 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -3 Query: 334 IMSTEDKQYLKLDNTKGXSDDRIIYGDSTADTFKHHWYLEPSMYESDV 191 +M+ +D +D T G SDD GD T + PS+ ES + Sbjct: 971 VMAGDDMMMESVDLTIGGSDDGSFAGDKTHSASPNR-LESPSLNESSL 1017 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.4 bits (48), Expect = 7.5 Identities = 15/62 (24%), Positives = 28/62 (45%) Frame = +2 Query: 554 ILCP*LVGEVHGVPLAVFDQTLHGFLDNLSLLFLQIFRAFGDSGLVFTNDDTHIQLLCQY 733 I C +VG VH VP + T + N+++ ++ + + +F DT I + + Sbjct: 159 IACLTMVGSVHSVPYIFYAGTQYSERSNVTICDMR--KEYTSQMEIFNYIDTVIVFVVPF 216 Query: 734 VI 739 I Sbjct: 217 TI 218 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.4 bits (48), Expect = 7.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 715 YMSVVIGEYETAIAKCSEYLKEKKGEV 635 YM +I + E +C + LKEK +V Sbjct: 550 YMEAIIVDTEKTARRCIQILKEKMLDV 576 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 334 IMSTEDKQYLKLDNTKGXSDDRIIYGDST 248 +M+ +D +D T G SDD GD T Sbjct: 969 VMAGDDMMMESVDLTIGGSDDGSFAGDKT 997 >Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase protein. Length = 250 Score = 23.0 bits (47), Expect = 9.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 130 ANEDREALGHSGEVSGYPQLFAWY 59 AN + GH E+ YP + A Y Sbjct: 5 ANNSKIVGGHEAEIGRYPWMVALY 28 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 23.0 bits (47), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 414 VTPKTKPARKSPGSLPP 364 VTP T+PA K + PP Sbjct: 81 VTPNTEPASKPSPNCPP 97 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.0 bits (47), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 414 VTPKTKPARKSPGSLPP 364 VTP T+PA K + PP Sbjct: 81 VTPNTEPASKPSPNCPP 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 784,671 Number of Sequences: 2352 Number of extensions: 17276 Number of successful extensions: 60 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -