BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m18r (776 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0C8K7 Cluster: Chromosome undetermined scaffold_158, w... 33 6.0 UniRef50_Q8IKC0 Cluster: Putative uncharacterized protein; n=1; ... 33 8.0 >UniRef50_A0C8K7 Cluster: Chromosome undetermined scaffold_158, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_158, whole genome shotgun sequence - Paramecium tetraurelia Length = 622 Score = 33.5 bits (73), Expect = 6.0 Identities = 20/56 (35%), Positives = 31/56 (55%) Frame = -2 Query: 418 VTSLCHLLVLRLQIKRTFIKRYIFL*LCEHLPTANTWFHRSSEPIRTYLKYRNIIV 251 +T +C+ R I TF K+YIF L EH P+ N W + + + I + + NI+V Sbjct: 69 ITKICYHS--RGYISETFTKQYIFAMLMEH-PSYNLWEYLNRQKILSQNQIINIVV 121 >UniRef50_Q8IKC0 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1313 Score = 33.1 bits (72), Expect = 8.0 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +3 Query: 9 NFNTRIL--SYYYYHRKT*G*LNNVNNTFANF*ESEGKIINV*KLRILSEVPVKNINYWN 182 N NT IL + Y +KT N+ N NF + + K IN+ K ++ +E+ + WN Sbjct: 969 NHNTDILFDGIFTYGKKT----QNIINDIINFYKIKNKDINILKFKVDAELQLNEKCIWN 1024 Query: 183 SFKLN 197 S LN Sbjct: 1025 SSTLN 1029 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,408,570 Number of Sequences: 1657284 Number of extensions: 11859479 Number of successful extensions: 20871 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20867 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 65438977305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -