BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m18r (776 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 26 0.39 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 24 1.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.8 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 22 4.8 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 25.8 bits (54), Expect = 0.39 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = +2 Query: 458 LEIVQLITYDRKKFRRMRLHCFIDFAVKYYLYVKRSKTV 574 +++ Q++ Y +KKF+RM + ++ +A + + S V Sbjct: 1195 IQLKQVVNYKKKKFQRMVVARYVYYATIFTIITATSSFV 1233 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +2 Query: 470 QLITYDRKKFRRMRLHCFIDFAVKYYLYVKRSKT 571 +++TY K+R++ C A + +L V + +T Sbjct: 515 KIVTYKGGKYRKVTFQCLKSIAWRAFLAVLKRRT 548 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.8 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -2 Query: 340 LCEHLPTANTWFHRSSEPIRTYLKYRNIIVYPFAYFVPKIGFLIVISLFN 191 + E +PT + S++ Y+ NI FAY K I+I F+ Sbjct: 358 ISEIIPTGDDTTMDSNDMTAIYVLLINIFASYFAYIFGKFACKIMIQGFS 407 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.8 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -2 Query: 340 LCEHLPTANTWFHRSSEPIRTYLKYRNIIVYPFAYFVPKIGFLIVISLFN 191 + E +PT + S++ Y+ NI FAY K I+I F+ Sbjct: 358 ISEIIPTGDDTTMDSNDMTAIYVLLINIFASYFAYIFGKFACKIMIQGFS 407 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.8 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -2 Query: 340 LCEHLPTANTWFHRSSEPIRTYLKYRNIIVYPFAYFVPKIGFLIVISLFN 191 + E +PT + S++ Y+ NI FAY K I+I F+ Sbjct: 358 ISEIIPTGDDTTMDSNDMTAIYVLLINIFASYFAYIFGKFACKIMIQGFS 407 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.8 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -2 Query: 340 LCEHLPTANTWFHRSSEPIRTYLKYRNIIVYPFAYFVPKIGFLIVISLFN 191 + E +PT + S++ Y+ NI FAY K I+I F+ Sbjct: 358 ISEIIPTGDDTTMDSNDMTAIYVLLINIFASYFAYIFGKFACKIMIQGFS 407 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 531 LLSNITYMSNDRKRSLAPICLL 596 LL+N+TY + +RK +C L Sbjct: 42 LLTNLTYNNTNRKYYWLNVCCL 63 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,442 Number of Sequences: 336 Number of extensions: 3688 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -