BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m18r (776 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9E9.03 |leu2||3-isopropylmalate dehydratase Leu2 |Schizosacc... 28 1.3 SPAP27G11.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 27 3.0 SPCC4E9.01c |rec11|SPCC550.16c|meiotic cohesin complex subunit R... 27 4.0 SPBC56F2.04 |utp20||U3 snoRNP protein Utp20|Schizosaccharomyces ... 26 5.2 SPBC11B10.01 |alg2|SPBC32H8.14|mannosyltransferase complex subun... 25 9.2 SPAC959.04c |||mannosyltransferase |Schizosaccharomyces pombe|ch... 25 9.2 >SPAC9E9.03 |leu2||3-isopropylmalate dehydratase Leu2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 758 Score = 28.3 bits (60), Expect = 1.3 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 357 DIFFYDCASTCPLPIPGFIDQVN 289 DIFF +C LPIP I+QVN Sbjct: 641 DIFFNNCFKNGMLPIPTPIEQVN 663 >SPAP27G11.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 689 Score = 27.1 bits (57), Expect = 3.0 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +1 Query: 274 SRYVWVHLIYETRYWQWASARTIIEKYIS 360 + Y+W LI E+ ++ + S ++ I KY++ Sbjct: 114 AEYIWKSLIPESIFYHFVSLQSFIRKYLT 142 >SPCC4E9.01c |rec11|SPCC550.16c|meiotic cohesin complex subunit Rec11|Schizosaccharomyces pombe|chr 3|||Manual Length = 923 Score = 26.6 bits (56), Expect = 4.0 Identities = 13/47 (27%), Positives = 28/47 (59%) Frame = +3 Query: 72 NVNNTFANF*ESEGKIINV*KLRILSEVPVKNINYWNSFKLNRLMTI 212 + N +AN+ E++ I++ KL ++P+ ++ + FK+N L+ I Sbjct: 420 HTNERYANYCEAKTATISLSKLLRREKIPLLVSSFESLFKMNALLFI 466 >SPBC56F2.04 |utp20||U3 snoRNP protein Utp20|Schizosaccharomyces pombe|chr 2|||Manual Length = 2493 Score = 26.2 bits (55), Expect = 5.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 424 PLVTSLCHLLVLRLQIKRTFIKRYIFL*LCEHLPTANTWFHRS 296 PL+ L L ++ + +K I + LC+ LPT W H S Sbjct: 1225 PLLNLLVSFLRKPNRLVPSNVKSNILVLLCKLLPTNTKWLHAS 1267 >SPBC11B10.01 |alg2|SPBC32H8.14|mannosyltransferase complex subunit Alg2|Schizosaccharomyces pombe|chr 2|||Manual Length = 511 Score = 25.4 bits (53), Expect = 9.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 254 CIPFCLFCTQDWIFDCH*P 198 C+PF L +Q +F CH P Sbjct: 121 CVPFLLLASQMILFYCHFP 139 >SPAC959.04c |||mannosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 298 Score = 25.4 bits (53), Expect = 9.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 713 HNCTYSNLTHFLISSG 760 HN TY+NL ++L+ SG Sbjct: 229 HNQTYTNLINYLLGSG 244 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,884,968 Number of Sequences: 5004 Number of extensions: 56363 Number of successful extensions: 118 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -