BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m18r (776 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55363-12|AAA97969.1| 320|Caenorhabditis elegans Hypothetical p... 29 3.7 >U55363-12|AAA97969.1| 320|Caenorhabditis elegans Hypothetical protein ZC404.11 protein. Length = 320 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = -2 Query: 271 KYRNIIVYPFAYFVPKIGFLIVISLFNLNEFQ*FIFFTGTSLNILSF----*TFIIFPSL 104 ++ ++V F GF V+ ++N++ + +NIL+F +FII+ +L Sbjct: 229 RFIQVVVVVFVITETPQGFFSVLGSISINDYINYYQHLSIFMNILAFFNTTTSFIIYSTL 288 Query: 103 S*KFANVLFTLF 68 S KF + LF Sbjct: 289 SSKFRKLFAQLF 300 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,476,055 Number of Sequences: 27780 Number of extensions: 302116 Number of successful extensions: 550 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1872168044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -