BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m14r (747 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.3 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 3.0 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 4.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 273 PHSTLYYERLRVVIINPIKNMYLESTDVYREKRTRLSAPCA 151 PHSTL Y+ ++ P K +S D +E T +A A Sbjct: 1072 PHSTLEYKVKERHLMRPRKRDQKQSDDKTKETSTVTAAAAA 1112 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.0 bits (47), Expect = 3.0 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +2 Query: 98 AAIIYKIYNILYNRGSRKAQGADNRVLFSL*TSVLSKYI 214 +++I + N+ +RGS G +N + + T+ SKY+ Sbjct: 173 SSVIEEAQNLKMSRGSSVVTGMNNIETYIVNTNYSSKYM 211 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 578 AFDSIGEWVECVEILDGHTIER 643 A SI E+ E+L HT+E+ Sbjct: 259 AMSSIAEFSVSTEVLQDHTLEK 280 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,347 Number of Sequences: 438 Number of extensions: 4394 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -