BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m14f (619 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U02588-1|AAA18901.1| 110|Anopheles gambiae translation initiati... 224 2e-60 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 24 4.5 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 24 4.5 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 6.0 AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like pepti... 23 6.0 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 23 6.0 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 7.9 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 7.9 >U02588-1|AAA18901.1| 110|Anopheles gambiae translation initiation factor protein. Length = 110 Score = 224 bits (548), Expect = 2e-60 Identities = 102/110 (92%), Positives = 107/110 (97%) Frame = +1 Query: 118 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRAC 297 MSIQNLNTFDPFADAIK ++ DVQDGLVH+RIQQRNGRKTLTTVQGLS+EYDLKKIVRAC Sbjct: 1 MSIQNLNTFDPFADAIKGADYDVQDGLVHIRIQQRNGRKTLTTVQGLSAEYDLKKIVRAC 60 Query: 298 KKEFACNGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 447 KKEFACNGTV+EHPEYGEVLQLQGDQRENICQWLTKSGL KPEQLKVHGF Sbjct: 61 KKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKSGLAKPEQLKVHGF 110 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.8 bits (49), Expect = 4.5 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 10/43 (23%) Frame = -1 Query: 304 PSCMPAR--SSSGHI------PRKGLA--P*SASYARFVAGYG 206 PS P SSSG P G A P +ASY RF+AG G Sbjct: 228 PSIFPTEVGSSSGRFRPILWTPENGYAEEPSNASYPRFIAGPG 270 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.8 bits (49), Expect = 4.5 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 10/43 (23%) Frame = -1 Query: 304 PSCMPAR--SSSGHI------PRKGLA--P*SASYARFVAGYG 206 PS P SSSG P G A P +ASY RF+AG G Sbjct: 228 PSIFPTEVGSSSGRFRPILWTPENGYAEEPSNASYPRFIAGPG 270 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.4 bits (48), Expect = 6.0 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +1 Query: 271 DLKKIVRACKKEFACNGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQL 432 DL ++V + ++F C V+ PE E+L LQ + I WLT+ + Q+ Sbjct: 532 DLMQMVSSQMQQFLCLQNVLLEPETDELL-LQFYEASAI--WLTQLSAREASQI 582 >AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 617 TTEEVARHRARTTVFSFLCRRRCSLNT 537 T EE HR R V + C + C+L+T Sbjct: 120 THEEHNFHRVRRQVVAECCYQSCTLDT 146 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 617 TTEEVARHRARTTVFSFLCRRRCSLNT 537 T EE HR R V + C + C+L+T Sbjct: 120 THEEHNFHRVRRQVVAECCYQSCTLDT 146 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +2 Query: 287 CGHARRSSRATVRSWSTRSTARCCSFRATSE 379 C ARR + R W T R S R +E Sbjct: 1064 CEAARRITTTLQRDWDTEREQRAASNREEAE 1094 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.0 bits (47), Expect = 7.9 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -3 Query: 227 PFRCWIRTWTK 195 P CWI WT+ Sbjct: 565 PIHCWIHPWTE 575 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,983 Number of Sequences: 2352 Number of extensions: 12831 Number of successful extensions: 22 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -