BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m07f (583 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 1.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.2 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.9 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.9 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 8.9 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 579 SHITCRRHKNNYFLAGFLVAFLVRTF 502 S I R H Y + GFL+A +V+ F Sbjct: 147 SGIVGRTHTVGYIIIGFLLAGIVQPF 172 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 234 SNTRSQPLLVL*GKRGQMLNSM 299 + T S+P+LVL G R ++L S+ Sbjct: 273 AQTGSEPMLVLSGPRTRLLGSV 294 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 234 SNTRSQPLLVL*GKRGQMLNSM 299 + T S+P+LVL G R ++L S+ Sbjct: 273 AQTGSEPMLVLSGPRTRLLGSV 294 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 198 ICCLGTPLPGPSTSARVWSITSTTLTNF 115 I CL P PG S ++ + L+N+ Sbjct: 5 ISCLVAPFPGASANSEAKRLYDDLLSNY 32 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.0 bits (42), Expect = 8.9 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -2 Query: 486 GIFFLPKVPARAAFTFKLLNTAVLARFLLTRAAVNLNLS*SVICARFSLFANF 328 GI L K P+R++ L ++L +V++ + RFS F F Sbjct: 543 GITILEKKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRF 595 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 202 LKPTPSHKIPPQI 240 +K P HK+PP I Sbjct: 62 VKYLPGHKLPPNI 74 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 273 KRGQMLNSMKNGQKVNGP 326 K ++ M NGQK+ GP Sbjct: 284 KISELEKEMLNGQKLQGP 301 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,268 Number of Sequences: 438 Number of extensions: 3585 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -