BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m06r (467 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 4.3 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 5.7 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 20 9.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 20 9.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 20 9.9 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 20 9.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 20 9.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 20 9.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 20 9.9 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 20 9.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 20 9.9 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 4.3 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 283 GSEETLSYISCSNGSFSRLLHEER 212 GS +S+++CS+ S+ + EER Sbjct: 340 GSLYHISFMACSSAGCSQKVAEER 363 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.0 bits (42), Expect = 5.7 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +1 Query: 373 ATTTRWVNQSARNSPY 420 +TT W +NSPY Sbjct: 130 STTIHWHGHHQKNSPY 145 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -3 Query: 351 PKKPMTDDVTGEALIKRSDDNVEALKKRLATYHAQT 244 P+ P G L D + +RLA+ H Q+ Sbjct: 53 PQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQS 88 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -3 Query: 351 PKKPMTDDVTGEALIKRSDDNVEALKKRLATYHAQT 244 P+ P G L D + +RLA+ H Q+ Sbjct: 53 PQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQS 88 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -3 Query: 351 PKKPMTDDVTGEALIKRSDDNVEALKKRLATYHAQT 244 P+ P G L D + +RLA+ H Q+ Sbjct: 53 PQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQS 88 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 84 RSVQILYSVFFSNRTLLISYLCENIVI 4 R VQI++ F S + L CE ++I Sbjct: 196 RMVQIIHKKFSSIQMQLKQSTCEAVMI 222 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -3 Query: 351 PKKPMTDDVTGEALIKRSDDNVEALKKRLATYHAQT 244 P+ P G L D + +RLA+ H Q+ Sbjct: 53 PQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQS 88 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -3 Query: 351 PKKPMTDDVTGEALIKRSDDNVEALKKRLATYHAQT 244 P+ P G L D + +RLA+ H Q+ Sbjct: 53 PQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQS 88 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -3 Query: 351 PKKPMTDDVTGEALIKRSDDNVEALKKRLATYHAQT 244 P+ P G L D + +RLA+ H Q+ Sbjct: 9 PQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQS 44 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -3 Query: 351 PKKPMTDDVTGEALIKRSDDNVEALKKRLATYHAQT 244 P+ P G L D + +RLA+ H Q+ Sbjct: 53 PQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQS 88 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -3 Query: 351 PKKPMTDDVTGEALIKRSDDNVEALKKRLATYHAQT 244 P+ P G L D + +RLA+ H Q+ Sbjct: 53 PQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQS 88 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,097 Number of Sequences: 336 Number of extensions: 1879 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10826639 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -