BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m06r (467 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G9.03 |adk1||adenylate kinase Adk1|Schizosaccharomyces pomb... 138 4e-34 SPCC1795.05c |||uridylate kinase|Schizosaccharomyces pombe|chr 3... 44 2e-05 >SPAC4G9.03 |adk1||adenylate kinase Adk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 220 Score = 138 bits (334), Expect = 4e-34 Identities = 62/102 (60%), Positives = 80/102 (78%) Frame = -3 Query: 462 LDAVIEFGIEDSLLVRRITGRLIHPPSGRSYHEEFHPPKKPMTDDVTGEALIKRSDDNVE 283 L+ V+E ++D LLVRRITGRL+HP SGRSYH EF+PPK PM DDVTGE LI+RSDDN + Sbjct: 111 LNTVLELQVDDELLVRRITGRLVHPGSGRSYHLEFNPPKVPMKDDVTGEPLIQRSDDNAD 170 Query: 282 ALKKRLATYHAQTVPLVDYYMRKGLHWRVDASKAADDVFNKI 157 AL+KRL TYH QT P+V++Y +KG VDA++ + V+ +I Sbjct: 171 ALRKRLVTYHEQTTPVVEFYKKKGKWAAVDAAQKPEQVWEQI 212 >SPCC1795.05c |||uridylate kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 191 Score = 43.6 bits (98), Expect = 2e-05 Identities = 19/46 (41%), Positives = 29/46 (63%) Frame = -3 Query: 303 RSDDNVEALKKRLATYHAQTVPLVDYYMRKGLHWRVDASKAADDVF 166 RSDDN+E++KKR TY ++P+V+Y + +DA + D VF Sbjct: 135 RSDDNIESIKKRFVTYTKASMPVVEYLKSQNRLITIDAEQDPDAVF 180 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,756,439 Number of Sequences: 5004 Number of extensions: 31824 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -