BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m06f (514 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 1.9 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 5.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.5 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 7.5 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 7.5 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 9.9 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 9.9 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 21 9.9 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +2 Query: 188 SEETLSYISCSNGSFSRLL 244 +EET+ Y+ +G+FSRL+ Sbjct: 172 AEETVDYMLEKSGNFSRLV 190 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/29 (24%), Positives = 17/29 (58%) Frame = -1 Query: 208 VAKRFFRASTLSSDLFIKASPVTSSVIGF 122 +AKR + T+ + + + + + S ++GF Sbjct: 472 IAKRLWLGETIEAKTYPEVTMLFSDIVGF 500 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/41 (21%), Positives = 18/41 (43%) Frame = +3 Query: 87 GRSYHEEFHPPKKPMTDDVTGEALIKRSDDNVEALKKRLAT 209 GRS+ + HP K D ++ ++ + + R A+ Sbjct: 195 GRSFIDYVHPKDKATLADQIKNGIVSPQEERPKGINGRRAS 235 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 120 KKPMTDDVTGEALIKRSDDNVEALKKRL 203 ++P+T+ TG+ L+ D V A K ++ Sbjct: 715 QEPVTNRPTGQLLLDYLTDTVLAYKPKI 742 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/41 (21%), Positives = 18/41 (43%) Frame = +3 Query: 87 GRSYHEEFHPPKKPMTDDVTGEALIKRSDDNVEALKKRLAT 209 GRS+ + HP K D ++ ++ + + R A+ Sbjct: 190 GRSFIDYVHPKDKATLADQIKNGIVSPQEERPKGINGRRAS 230 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 44 QTVLDSELDYGVQC 3 Q +LD LDY + C Sbjct: 56 QFILDVRLDYRISC 69 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 20.6 bits (41), Expect = 9.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 372 YLN*RSVQILYSVFFSNRTLLISYLC 449 Y+ R + Y+V T+LIS+LC Sbjct: 226 YIIIRRKTLFYTVNLILPTVLISFLC 251 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 44 QTVLDSELDYGVQC 3 Q +LD LDY + C Sbjct: 24 QFILDVRLDYRISC 37 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,234 Number of Sequences: 438 Number of extensions: 2359 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -