BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m03r (776 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17150.1 68415.m01980 RWP-RK domain-containing protein simila... 29 3.4 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 29 4.5 At1g18790.1 68414.m02342 RWP-RK domain-containing protein contai... 29 4.5 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 28 6.0 >At2g17150.1 68415.m01980 RWP-RK domain-containing protein similar to nodule inception protein [Lotus japonicus] GI:6448579; contains Pfam profile: PF02042 RWP-RK domain Length = 909 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +2 Query: 545 FVLHFFFSKSELGTKKAKENAKSYC--LIY*FHKYSRFIAEAQL 670 FVL FFF K+ L T+ +E KS C L F + FI + +L Sbjct: 435 FVLEFFFPKACLDTEAQQEMLKSLCVTLQQDFRSSNLFIKDLEL 478 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 118 EQKYILFSLNIDNNRFNFCVATAKNVNIHLSSLQFVEL 231 +Q +LF L++ NNRF V +HL SL+F++L Sbjct: 167 KQLKLLFELDLSNNRF---AGKFPTVVLHLPSLKFLDL 201 >At1g18790.1 68414.m02342 RWP-RK domain-containing protein contains Pfam profile: PF02042 RWP-RK domain Length = 269 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 349 TCIAKPRNTKTRNFSSFYAKKLISKQSISLLFFLHI 456 T K R + FSS K +SK++ISL F++ I Sbjct: 106 TTTTKKRRCREECFSSCSVSKTLSKETISLYFYMPI 141 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +1 Query: 130 ILFSLNIDNNRFNFCVATAKNVNIHLSSLQFVEL 231 +LF L++ NNRF V NV + L SL+F++L Sbjct: 190 LLFELDLSNNRF---VGKFPNVVLSLPSLKFLDL 220 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,207,763 Number of Sequences: 28952 Number of extensions: 263743 Number of successful extensions: 472 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1736283200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -