BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10m01f (624 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 32 0.27 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 32 0.27 At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 32 0.36 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 1.4 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 28 4.4 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 28 4.4 At3g43890.1 68416.m04698 DC1 domain-containing protein contains ... 27 7.7 At1g64260.1 68414.m07281 zinc finger protein-related contains Pf... 27 7.7 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 32.3 bits (70), Expect = 0.27 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +2 Query: 95 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRR 262 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 285 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 343 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 32.3 bits (70), Expect = 0.27 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +2 Query: 95 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRR 262 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 286 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 344 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 31.9 bits (69), Expect = 0.36 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 242 LIIDKRRNTMEYCYKLWVGNGQEIVRKYFPLNF 340 +++D + EY KL + +G + KYFPL F Sbjct: 386 IVVDTKNLNCEYQLKLMIASGVDAANKYFPLAF 418 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 68 MLAASAGVVELSADTSNQDLEEKLYNSILTGDYD 169 +LA + G ELS + Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSPSPAEQEIESFLYNAINMGFFD 103 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 134 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 250 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 134 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 250 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At3g43890.1 68416.m04698 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +3 Query: 42 NFSLYLRCACSPPAR--ASLN---YPRTLLTKTSRRNCTT 146 NFSL L+C PP + LN +P TL+ K+ CTT Sbjct: 228 NFSLDLQCVFHPPKQNPHDLNIHDHPLTLMPKSISFTCTT 267 >At1g64260.1 68414.m07281 zinc finger protein-related contains Pfam profiles PF03108: MuDR family transposase, PF04434: SWIM zinc finger Length = 719 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 242 LIIDKRRNTMEYCYKLWVGNGQEIVRKYFPLNF 340 +++D + +Y KL + +G + K+FPL F Sbjct: 379 IVVDTKSLNGKYQLKLMIASGVDAANKFFPLAF 411 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,040,056 Number of Sequences: 28952 Number of extensions: 265467 Number of successful extensions: 703 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -