BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l23f (599 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 25 1.9 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 3.3 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 5.7 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 7.5 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 7.5 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 23 7.5 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 10.0 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 23 10.0 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 10.0 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 25.0 bits (52), Expect = 1.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 289 SRAPRTSSVIVSQLSSDLSSPKTPLSL 369 S + +SS + S SS SSP +PLSL Sbjct: 112 SSSSSSSSSMSSSSSSSFSSPDSPLSL 138 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 3.3 Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Frame = +3 Query: 153 ADYDSAVEKSKHLYEEKKS-----EVITNVVNKLIRNNKMNCMEYAYQLWLQGSK 302 AD+ H+Y E+K ++ N + K R+N + M+Y + + + K Sbjct: 677 ADFCDVWINIAHIYVEQKQYISAIQMYENCLKKFYRHNNVEVMQYLARAYFRAGK 731 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.4 bits (48), Expect = 5.7 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = +3 Query: 111 NDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWL 290 +D +EQ Y + D + + + +E K E TNV + I ++ + + W Sbjct: 565 DDESKEQTYGDPKIEDNPTESVEIEWSLDETKREAKTNVADDTISESEFYGWDCSDDGWP 624 Query: 291 QG 296 QG Sbjct: 625 QG 626 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 298 PRTSSVIVSQLSSDLSSPKTPLSLCTSA 381 P +IVS LS D ++ TPL++ + A Sbjct: 116 PVKGQIIVSLLSRDSATGGTPLAIVSPA 143 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Frame = +2 Query: 203 EERSHHKCSEQTDT----KQQDELHGVRLSTLA 289 EE+ H +C++Q++T KQ ++ S LA Sbjct: 484 EEKHHERCAKQSETTRIEKQLEQFESAPRSKLA 516 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 545 LVTLSVQDLEVDLVVLPQSNELPAD 471 LV +++L V LPQ+NE AD Sbjct: 814 LVDAHLEELRVRFECLPQANESVAD 838 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 536 LSVQDLEVDLVVLPQSNELPADF 468 +S++ +E+ + + NELPADF Sbjct: 173 VSLEFMEIMANLRDEKNELPADF 195 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 22.6 bits (46), Expect = 10.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 290 PGLQGHRP*LFPS 328 PGL+G RP FP+ Sbjct: 35 PGLEGRRPVTFPN 47 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 450 KDKTSPKVSWKFIALWENNK 509 KDK PK+SW +NN+ Sbjct: 529 KDKLYPKISWFGKGFGKNNE 548 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 568,297 Number of Sequences: 2352 Number of extensions: 10708 Number of successful extensions: 22 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -