BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l20f (617 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 35 0.050 At1g64260.1 68414.m07281 zinc finger protein-related contains Pf... 30 1.1 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 1.4 At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 29 1.9 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 29 1.9 At4g16940.1 68417.m02555 disease resistance protein (TIR-NBS-LRR... 29 1.9 At1g49920.1 68414.m05598 zinc finger protein-related weak simila... 29 1.9 At5g66720.2 68418.m08411 5-azacytidine resistance protein -relat... 28 4.3 At5g66720.1 68418.m08410 5-azacytidine resistance protein -relat... 28 4.3 At5g10290.1 68418.m01194 leucine-rich repeat family protein / pr... 28 5.7 At4g21550.1 68417.m03113 transcriptional factor B3 family protei... 27 7.5 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 34.7 bits (76), Expect = 0.050 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 255 LIIDKRRNTMEYCYKLWVGNGQDIVKKYFPLSF 353 +++D + EY KL + +G D KYFPL+F Sbjct: 386 IVVDTKNLNCEYQLKLMIASGVDAANKYFPLAF 418 >At1g64260.1 68414.m07281 zinc finger protein-related contains Pfam profiles PF03108: MuDR family transposase, PF04434: SWIM zinc finger Length = 719 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 255 LIIDKRRNTMEYCYKLWVGNGQDIVKKYFPLSF 353 +++D + +Y KL + +G D K+FPL+F Sbjct: 379 IVVDTKSLNGKYQLKLMIASGVDAANKFFPLAF 411 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +3 Query: 72 VLAASAGVVELSADSMSPSNQDLEDKLYNSILTGDYD 182 VLA + G ELS SP+ Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSP---SPAEQEIESFLYNAINMGFFD 103 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 29.5 bits (63), Expect = 1.9 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +3 Query: 117 MSPSNQDLE-DKLY--NSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRR 275 M NQ E +KL+ NS L+ Y ++ S ++E+Q + + QNV ++DK R Sbjct: 288 MEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 343 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 29.5 bits (63), Expect = 1.9 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +3 Query: 117 MSPSNQDLE-DKLY--NSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRR 275 M NQ E +KL+ NS L+ Y ++ S ++E+Q + + QNV ++DK R Sbjct: 289 MEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 344 >At4g16940.1 68417.m02555 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1103 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 151 SLSSRSWLEGLMLSADSSTTPALAASTHIAN 59 S+S WLEG L DS T A HIAN Sbjct: 1065 SVSFNPWLEGEALCVDSMITEQQDAQIHIAN 1095 >At1g49920.1 68414.m05598 zinc finger protein-related weak similarity to mudrA [Zea mays] GI:540581, MURAZC [Zea mays] GI:1857256; contains Pfam profiles PF03108: MuDR family transposase, PF04434: SWIM zinc finger Length = 785 Score = 29.5 bits (63), Expect = 1.9 Identities = 22/76 (28%), Positives = 36/76 (47%) Frame = +3 Query: 126 SNQDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRNTMEYCYKLW 305 SN L D Y+S LT D + A + L + Q+ +++D + +Y KL Sbjct: 340 SNGLLVDWQYDS-LTHDPEHASFRGLFWAFSQSIQGFQHCRPLIVVDTKNLGGKYKMKLM 398 Query: 306 VGNGQDIVKKYFPLSF 353 + + D +YFPL+F Sbjct: 399 IASAFDATNQYFPLAF 414 >At5g66720.2 68418.m08411 5-azacytidine resistance protein -related contains weak similarity to 5-azacytidine resistance protein azr1 (Swiss-Prot:Q09189) [Schizosaccharomyces pombe] Length = 411 Score = 28.3 bits (60), Expect = 4.3 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = +3 Query: 105 SADSMSPSNQDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRNT 281 S D + + D LYN +TG S+VR L + +G + + +DK+R + Sbjct: 324 SGDVIVAGTDGVYDNLYNEEITGVVVSSVRAGL--DPKGTAQKIAELARQRAVDKKRQS 380 >At5g66720.1 68418.m08410 5-azacytidine resistance protein -related contains weak similarity to 5-azacytidine resistance protein azr1 (Swiss-Prot:Q09189) [Schizosaccharomyces pombe] Length = 414 Score = 28.3 bits (60), Expect = 4.3 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = +3 Query: 105 SADSMSPSNQDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRNT 281 S D + + D LYN +TG S+VR L + +G + + +DK+R + Sbjct: 327 SGDVIVAGTDGVYDNLYNEEITGVVVSSVRAGL--DPKGTAQKIAELARQRAVDKKRQS 383 >At5g10290.1 68418.m01194 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 613 Score = 27.9 bits (59), Expect = 5.7 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 96 VELSADSMSPSN---QDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIID 266 ++L+ D+ S N Q K+Y +L + AV++ ++ES G + Q V + + Sbjct: 283 LQLATDNFSEKNVLGQGGFGKVYKGVLPDNTKVAVKRLTDFESPGGDAAFQREVEMISVA 342 Query: 267 KRRNTM 284 RN + Sbjct: 343 VHRNLL 348 >At4g21550.1 68417.m03113 transcriptional factor B3 family protein low similarity to SP|Q01593 Abscisic acid-insensitive protein 3 {Arabidopsis thaliana}, SP|P37398 Viviparous protein homolog {Oryza sativa}; contains Pfam profile PF02362: B3 DNA binding domain Length = 721 Score = 27.5 bits (58), Expect = 7.5 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = -3 Query: 231 CCPGLGSRIPSSYVQHCRSHR*GCCCTVC---PRGLG*K-GSCC 112 C G I + +H R HR GC C +C P G+G K CC Sbjct: 545 CTEVEGLLISPTTTKHPR-HRDGCTCIICIQSPSGIGPKHDRCC 587 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,240,112 Number of Sequences: 28952 Number of extensions: 245867 Number of successful extensions: 676 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -