BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l19f (586 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 26 0.27 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 7.7 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 25.8 bits (54), Expect = 0.27 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -2 Query: 459 YIVCNFFFRGSVFIILTSFIIVTFISRLITVITKLTQIFSRYYLTFVLFT 310 Y + F ++ ++FII T V+ L I+ YY F+LFT Sbjct: 201 YFTLHLLFLPCIYYFYSAFIIFTIHLLFYCVLIILLCIYYFYY-AFILFT 249 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 345 FSRYYLTFVLFTDFAQ*INVTF 280 F +LT +LF +F Q +NV + Sbjct: 246 FLANFLTNLLFWEFDQIVNVAY 267 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,365 Number of Sequences: 336 Number of extensions: 1416 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -