SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner10l19f
         (586 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0437 - 33912326-33912520,33912870-33912998,33913147-339133...    28   4.8  

>03_06_0437 -
           33912326-33912520,33912870-33912998,33913147-33913317,
           33913877-33913993,33914150-33914800
          Length = 420

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 5/45 (11%)
 Frame = +2

Query: 398 MIKLVRMIKTEPLKKKLQTMYYQ-----KHQILTLIIHQTEKVMI 517
           M+K+   + T PL +KL T+Y         ++L  IIH+T K ++
Sbjct: 256 MVKIGLRVLTRPLPEKLPTIYRSLGENFNERVLPSIIHETLKAVV 300


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,894,742
Number of Sequences: 37544
Number of extensions: 126871
Number of successful extensions: 307
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 307
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 307
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1376330256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -