BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l19f (586 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0437 - 33912326-33912520,33912870-33912998,33913147-339133... 28 4.8 >03_06_0437 - 33912326-33912520,33912870-33912998,33913147-33913317, 33913877-33913993,33914150-33914800 Length = 420 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Frame = +2 Query: 398 MIKLVRMIKTEPLKKKLQTMYYQ-----KHQILTLIIHQTEKVMI 517 M+K+ + T PL +KL T+Y ++L IIH+T K ++ Sbjct: 256 MVKIGLRVLTRPLPEKLPTIYRSLGENFNERVLPSIIHETLKAVV 300 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,894,742 Number of Sequences: 37544 Number of extensions: 126871 Number of successful extensions: 307 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 307 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -