BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l17r (766 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21510| Best HMM Match : zf-C2H2 (HMM E-Value=6.3e-07) 30 2.3 SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_21510| Best HMM Match : zf-C2H2 (HMM E-Value=6.3e-07) Length = 229 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 7/75 (9%) Frame = +3 Query: 417 IYVHFGMLDTSKSLVLKIAKGFELHITNYNLALNSIGTQKYRYANI-------EPAKIQL 575 I+VH +L S+ VL + ++ + N ++ L ++ N+ EPAK L Sbjct: 138 IFVH--ILGKSRINVLSVPNALQILVVNKSILLYTLDRDHINVINVVNALHRLEPAKNML 195 Query: 576 VHVIDTINIKVLKAL 620 +H+++ +I VL + Sbjct: 196 LHILERSHITVLSVM 210 >SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/47 (21%), Positives = 23/47 (48%) Frame = -3 Query: 668 TRAYKICLRK*YPINTQGF*YFYIYCIDYMYQLNFSRLNICISIFLC 528 TR + +C + F + C+ ++Y + F+ +++C + LC Sbjct: 71 TRCFSLCFPGVFRYVFPVFFALFAQCLRFVYPVFFAMISLCFYVLLC 117 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,185,013 Number of Sequences: 59808 Number of extensions: 305779 Number of successful extensions: 443 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -