BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l17r (766 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 24 4.5 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 7.8 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 562 AGSIFAYLYFCVPILFNAKL*FVMWSSKPLAI 467 +GS ++ Y CVP+ +A F+ KP+ I Sbjct: 43 SGSCLSFSYKCVPVPASASEGFISVPVKPVPI 74 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.4 bits (48), Expect = 7.8 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = -1 Query: 745 IFLYLMSYFKAHLFNVRLLLDYYRTRREL 659 + + L+S+F +F +++YY R++L Sbjct: 374 VVMSLISFFFPMIFEALGIIEYYHPRKQL 402 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,432 Number of Sequences: 2352 Number of extensions: 12018 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -