BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l17f (658 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 1.9 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 4.5 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 21 7.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.8 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 7.8 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 182 GDPPTPRGVPLPAAPTPRPSVLAPLAA 102 GD TP P PA P P PS P +A Sbjct: 333 GDSDTP---PKPAPPPPPPSSSGPDSA 356 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 167 PRGVPLPAAPTPRPSVLAPLAASA 96 PRG LP TP P+ + L A Sbjct: 151 PRGGSLPTPVTPTPTTVQQLLRRA 174 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 363 PENSMDIPPTMFR 325 PE++MD PT FR Sbjct: 23 PEDTMDYIPTRFR 35 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.8 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = -3 Query: 182 GDPPTPRGVPLP-----AAPTPRPSVLAPLAASAVRQ 87 G PP P P P A P+ PS + AS + Q Sbjct: 37 GSPPNPSQGPPPGGPPGAPPSQNPSQMMISPASGIHQ 73 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = +1 Query: 283 SSIPFVDVLRARLSSEHSRRDVHTVLGRWL 372 S++PF + A L+++ + D ++ RW+ Sbjct: 308 STVPFNFMFIADLNNQSTASDFKQLIDRWV 337 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,687 Number of Sequences: 438 Number of extensions: 4318 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -