BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l15f (616 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13E7.02 |cwf24||GCN5-related N acetyltransferase|Schizosacch... 27 2.2 SPAC1834.09 |mug51||conserved fungal protein|Schizosaccharomyces... 27 2.2 SPAC24H6.10c |||phospho-2-dehydro-3-deoxyheptonate aldolase |Sch... 26 5.0 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 25 8.7 >SPBC13E7.02 |cwf24||GCN5-related N acetyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 27.1 bits (57), Expect = 2.2 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +1 Query: 511 SIVCETCGRCRCEQCA--RPRPLPSRWLCGS 597 S + TCG CEQCA R R P+ CG+ Sbjct: 263 SPIATTCGHHFCEQCAITRYRKTPTCIQCGA 293 >SPAC1834.09 |mug51||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 27.1 bits (57), Expect = 2.2 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = -2 Query: 156 FLLLISTTAFFVTVPNSCGFTALILIHILMENRER*RYAPTKRPFRSLAHSA 1 FL+L T ++ +++PN FT HIL +R KRP+R + S+ Sbjct: 205 FLILAGTDSYGISLPNLGIFT-----HILRNSRNDLSNYLKKRPYREVIESS 251 >SPAC24H6.10c |||phospho-2-dehydro-3-deoxyheptonate aldolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 368 Score = 25.8 bits (54), Expect = 5.0 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 89 SAVNPHEFGTVTKNAVVEI 145 S+ NPH F +VTK VV I Sbjct: 216 SSANPHHFLSVTKQGVVAI 234 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 25.0 bits (52), Expect = 8.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 526 TCGRCRCEQCARPRPLPSRWLCGSCLCS 609 T G C C R R PS++ C SC C+ Sbjct: 399 TNGGCYSYIC-RSRSCPSKYQCYSCRCA 425 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,756,388 Number of Sequences: 5004 Number of extensions: 23753 Number of successful extensions: 57 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -