BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l15f (616 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 28 5.2 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 28 6.9 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 28.3 bits (60), Expect = 5.2 Identities = 18/63 (28%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = +1 Query: 394 RTH-VSPAAAHAGAHQPLKPVTTQPXXXXXXXXXXXXXXDSIVCETCGRCRCEQCARPRP 570 RTH V+P A+ G + + T QP + C TC C +CA Sbjct: 179 RTHCVTPLASQTGPDREEEQSTGQPPDLSRCSTHTNEEF-AFYCHTCSTLVCRECAVEHE 237 Query: 571 LPS 579 PS Sbjct: 238 KPS 240 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +3 Query: 102 RTSSERSQKTPSSRSEVEINEELQRGSGDDEGTGRR 209 R S S+ PSS S N L+RG D G RR Sbjct: 347 RRESRNSESKPSSSSSKNRNTGLERGRVQDFGRDRR 382 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,514,966 Number of Sequences: 59808 Number of extensions: 213172 Number of successful extensions: 897 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -