BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l14r (432 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY075428-1|AAL68244.1| 450|Drosophila melanogaster LD47671p pro... 30 1.5 AE014134-1099|AAF52388.1| 450|Drosophila melanogaster CG9536-PA... 30 1.5 >AY075428-1|AAL68244.1| 450|Drosophila melanogaster LD47671p protein. Length = 450 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 202 KCFMTKYFGVSLSSLLFIKFYVSRTKYKLITFQIH 98 K F FGVSL + ++ FY TK I F++H Sbjct: 106 KFFALSNFGVSLLTTVYYLFYYMVTKNPTILFEVH 140 >AE014134-1099|AAF52388.1| 450|Drosophila melanogaster CG9536-PA protein. Length = 450 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 202 KCFMTKYFGVSLSSLLFIKFYVSRTKYKLITFQIH 98 K F FGVSL + ++ FY TK I F++H Sbjct: 106 KFFALSNFGVSLLTTVYYLFYYMVTKNPTILFEVH 140 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,725,869 Number of Sequences: 53049 Number of extensions: 315630 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1355285490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -