BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l14f (482 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15A10.02 |taf12||transcription factor TFIID complex subunit ... 26 2.6 SPBC354.12 |gpd3||glyceraldehyde 3-phosphate dehydrogenase Gpd3|... 25 7.9 >SPAC15A10.02 |taf12||transcription factor TFIID complex subunit A |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 26.2 bits (55), Expect = 2.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 286 LINNKEDSDTPKYFVIKHLVKI 221 L NN E S TP Y HL K+ Sbjct: 274 LANNVEKSQTPSYMSANHLPKV 295 >SPBC354.12 |gpd3||glyceraldehyde 3-phosphate dehydrogenase Gpd3|Schizosaccharomyces pombe|chr 2|||Manual Length = 335 Score = 24.6 bits (51), Expect = 7.9 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +1 Query: 34 DVHERR*PLTISWAVCSSAYTALKNKITS*LCSSSTHIR 150 DVH R P I W+ + Y + + ++S H++ Sbjct: 75 DVHNERDPANIKWSASGAEYVIESTGVFTTKETASAHLK 113 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,902,791 Number of Sequences: 5004 Number of extensions: 36031 Number of successful extensions: 54 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 186042952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -