BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l13f (642 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0800 - 7047425-7048253,7048340-7048927,7049050-7049268,704... 29 4.1 10_07_0057 + 12460986-12461036,12461108-12461161,12461420-124614... 29 4.1 11_06_0224 + 21447875-21448944,21449465-21449624 28 7.2 06_03_1104 + 27623632-27623795,27624052-27624175,27624316-276248... 27 9.6 02_04_0131 - 20046033-20046505,20047140-20047233,20047343-200474... 27 9.6 >11_01_0800 - 7047425-7048253,7048340-7048927,7049050-7049268, 7049398-7049518,7050593-7050983 Length = 715 Score = 28.7 bits (61), Expect = 4.1 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 3/69 (4%) Frame = +2 Query: 149 NCTTASSPVTTTVLYVRAWNTRAKARAASFKM*LTI*SLTRDGTPWSTATSCGSATD--- 319 +C TAS +L+ K R + I + R W+ SCG+ D Sbjct: 579 DCATASDTTQIKLLFGAKGAVHIKGRCIGGERRFAIYRMERGVDKWTVKCSCGATDDDGE 638 Query: 320 RILSKSTSH 346 R+LS T H Sbjct: 639 RMLSCDTCH 647 >10_07_0057 + 12460986-12461036,12461108-12461161,12461420-12461482, 12461666-12461716,12461996-12462057,12462156-12462318, 12462829-12462939,12463029-12463166,12463248-12463322, 12463420-12463540,12464827-12464981,12465080-12465154, 12465270-12465473,12465670-12465786 Length = 479 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -2 Query: 365 MMSLKLNGKYFLTISCPLPTHSL*QYSMVFRLLSMI 258 MM L + GK I CP+P+HSL SMV R +++ Sbjct: 152 MMHLLIRGKKD-GILCPIPSHSLYTDSMVLRGATLV 186 >11_06_0224 + 21447875-21448944,21449465-21449624 Length = 409 Score = 27.9 bits (59), Expect = 7.2 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -2 Query: 170 VRMLLYSLSSRSWLEGLMLSADSSTTPALAASTHIANTTRSFILLGAFS 24 +R +L +L + + LML T+PA+AA+ + N T FI + A S Sbjct: 133 LRFVLLALGGVTGFQALMLQGMKRTSPAIAAA--MPNLTPGFIFVVAAS 179 >06_03_1104 + 27623632-27623795,27624052-27624175,27624316-27624832, 27624943-27625073,27625161-27625567,27625690-27625963, 27626195-27626814,27627424-27627859 Length = 890 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +1 Query: 286 EYCYKLWVGNGQDIVKKYFPLSFRLIMAGNYVKLIYRNYNLALKLGSTTNPSNERIA 456 +YC V + D+ + L L + GN ++ N +L K+G+ SN IA Sbjct: 248 QYC----VASEMDVAVRVLKLYAALALCGNGAMVLLNNEDLMAKVGALLGKSNPSIA 300 >02_04_0131 - 20046033-20046505,20047140-20047233,20047343-20047434, 20047560-20047611,20047721-20047878,20048190-20048280, 20048397-20049455 Length = 672 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +1 Query: 109 ADSMSPSNQDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVV 249 +DS+ + + D N DY+S+ R+S QGQ ++ +V Sbjct: 110 SDSILAATDNTNDSADNCTRDVDYNSSGRRSTTSHDQGQHDVLSEIV 156 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,356,093 Number of Sequences: 37544 Number of extensions: 331493 Number of successful extensions: 982 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -