BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l09r (745 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 25 3.3 Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor prot... 23 10.0 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 10.0 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 10.0 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 24.6 bits (51), Expect = 3.3 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -3 Query: 155 KEINEAFHLMHAGKSIRAVVDM*FLRKN-IYT-IFVHLLNLFSSAFTTKYN 9 K NE +++ G+ I ++ + + +Y IF +N+F SA++ YN Sbjct: 437 KSTNEIWNIFFGGRYIILLMGLFSMYTGFVYNDIFSKSMNIFGSAWSVNYN 487 >Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor protein. Length = 211 Score = 23.0 bits (47), Expect = 10.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 108 DRFSSMHQMECLIDLLQRHIVSDKFV*RQLL 200 D F + + L+DL R++++DK V + LL Sbjct: 31 DDFVGLLPLNDLLDLAMRYLLTDKEVQQTLL 61 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 10.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 492 KFIDSKFLSYLKLVRVDVNTNNAIGTC 572 + D +Y KLVR VNT++ + C Sbjct: 30 RLYDDLLSNYNKLVRPVVNTSDVLRVC 56 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 10.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 492 KFIDSKFLSYLKLVRVDVNTNNAIGTC 572 + D +Y KLVR VNT++ + C Sbjct: 30 RLYDDLLSNYNKLVRPVVNTSDVLRVC 56 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,620 Number of Sequences: 2352 Number of extensions: 14559 Number of successful extensions: 24 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -