BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l09f (627 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.3 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 7.4 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.8 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 9.8 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 1.8 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +1 Query: 130 KPVKCALRSRPPESAILTRIHSPEKIL 210 + + C LR+ P +L +H+ ++L Sbjct: 1102 RDLPCVLRASTPAPVVLEAVHASRRVL 1128 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 223 GNTPSGSFPESVYASVWQTPVAVILTRTSPAFGGSTS 113 G S +F + +A+ +P +L R SPAF G++S Sbjct: 900 GEPTSAAFAQG-FATAASSPG--LLERASPAFSGTSS 933 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 474 FSQYTVVLEISLCKV 518 + QY VL +SLCK+ Sbjct: 102 WQQYPWVLGVSLCKI 116 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.0 bits (42), Expect = 9.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 561 RIPANKLYLMEQPLQLY 511 R P ++ +EQP+Q+Y Sbjct: 287 RTPTYRMQQVEQPVQVY 303 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.0 bits (42), Expect = 9.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 561 RIPANKLYLMEQPLQLY 511 R P ++ +EQP+Q+Y Sbjct: 287 RTPTYRMQQVEQPVQVY 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,880 Number of Sequences: 438 Number of extensions: 3826 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -