BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l05r (380 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98860-2|CAB11545.1| 337|Caenorhabditis elegans Hypothetical pr... 29 1.5 Z82073-5|CAB63322.1| 333|Caenorhabditis elegans Hypothetical pr... 28 2.0 AF016450-5|AAB65984.2| 280|Caenorhabditis elegans Serpentine re... 26 7.9 >Z98860-2|CAB11545.1| 337|Caenorhabditis elegans Hypothetical protein Y26G10.2 protein. Length = 337 Score = 28.7 bits (61), Expect = 1.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 239 TVANCSRNKFFLTIHVLSVICCWYCN 316 T N K+FL H+ S+ C W C+ Sbjct: 45 TPKNFGSLKWFLVFHIFSITCQWLCS 70 >Z82073-5|CAB63322.1| 333|Caenorhabditis elegans Hypothetical protein W06D12.7 protein. Length = 333 Score = 28.3 bits (60), Expect = 2.0 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 263 KFFLTIHVLSVICCWYCNKPFLDCQY*LQSFIT 361 K+FL+ H+ ++ C W C+ +D + S IT Sbjct: 47 KWFLSFHIFAITCQWLCSFLLIDFYTFVPSKIT 79 >AF016450-5|AAB65984.2| 280|Caenorhabditis elegans Serpentine receptor, class t protein68 protein. Length = 280 Score = 26.2 bits (55), Expect = 7.9 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +2 Query: 269 FLTIHVLSVICCWY 310 F+T+H+ S+IC W+ Sbjct: 227 FVTVHITSMICVWH 240 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,268,710 Number of Sequences: 27780 Number of extensions: 151281 Number of successful extensions: 308 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 308 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 567749674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -