BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l03r (777 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0100 - 26424769-26425545,26425666-26425697,26425778-264258... 29 5.4 09_06_0128 + 21026454-21026909 28 7.2 >01_06_0100 - 26424769-26425545,26425666-26425697,26425778-26425894, 26426067-26426118,26426229-26426281,26426883-26427585 Length = 577 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/48 (29%), Positives = 28/48 (58%) Frame = -1 Query: 621 VKKVLSHQVKNLMKRNLPKTTMKKKKVLNPNQLKNHTKKNIVRKPTMK 478 +KK ++ + M+R + K TM K+++ +K T+K +++ TMK Sbjct: 376 MKKKMTMKRMMTMRRKM-KRTMMKRRMRKRTTMKRRTRKRTMKRRTMK 422 >09_06_0128 + 21026454-21026909 Length = 151 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -1 Query: 630 KRKVKKVLSHQVKNLMKRNLPKTTMKKKKVLNPNQLKNHTK 508 +RK+K ++ ++K + K+ PK MKK K Q K TK Sbjct: 3 RRKMKAMVKRKMKAMGKKK-PKVPMKKTKAQRKKQPKASTK 42 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,639,047 Number of Sequences: 37544 Number of extensions: 216742 Number of successful extensions: 620 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2080154268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -