BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l03r (777 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U63744-1|AAC47308.1| 572|Caenorhabditis elegans p21-activated k... 29 4.9 U29612-10|AAA68805.2| 572|Caenorhabditis elegans P21-activated ... 29 4.9 U29612-9|AAL65775.1| 569|Caenorhabditis elegans P21-activated k... 29 4.9 D83215-1|BAA11844.1| 569|Caenorhabditis elegans protein kinase ... 29 4.9 Z49909-1|CAA90105.1| 298|Caenorhabditis elegans Hypothetical pr... 28 6.5 >U63744-1|AAC47308.1| 572|Caenorhabditis elegans p21-activated kinase CePAK protein. Length = 572 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 570 PKTTMKKKKVLNPNQLKNHTKKNIVRKPTM 481 P+ T KKK + NP KN KK KP + Sbjct: 38 PEATKKKKTMPNPFMKKNKDKKEASEKPVI 67 >U29612-10|AAA68805.2| 572|Caenorhabditis elegans P21-activated kinase family protein1, isoform a protein. Length = 572 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 570 PKTTMKKKKVLNPNQLKNHTKKNIVRKPTM 481 P+ T KKK + NP KN KK KP + Sbjct: 38 PEATKKKKTMPNPFMKKNKDKKEASEKPVI 67 >U29612-9|AAL65775.1| 569|Caenorhabditis elegans P21-activated kinase family protein1, isoform b protein. Length = 569 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 570 PKTTMKKKKVLNPNQLKNHTKKNIVRKPTM 481 P+ T KKK + NP KN KK KP + Sbjct: 38 PEATKKKKTMPNPFMKKNKDKKEASEKPVI 67 >D83215-1|BAA11844.1| 569|Caenorhabditis elegans protein kinase protein. Length = 569 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 570 PKTTMKKKKVLNPNQLKNHTKKNIVRKPTM 481 P+ T KKK + NP KN KK KP + Sbjct: 38 PEATKKKKTMPNPFMKKNKDKKEASEKPVI 67 >Z49909-1|CAA90105.1| 298|Caenorhabditis elegans Hypothetical protein C14A4.1 protein. Length = 298 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = +1 Query: 199 ALLHLLKCVRAFLFRYVHGYVLQRRADSFHVSLLRVRFLLHVQYAPVRHE 348 AL L C + LFR+ YVL + L+ R LL + VRHE Sbjct: 197 ALAQGLYCEDSALFRHEVAYVLGQLQSPVATQELKDRLLLSTENCMVRHE 246 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,239,152 Number of Sequences: 27780 Number of extensions: 207389 Number of successful extensions: 746 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1872168044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -