BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l03f (637 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 31 0.011 AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 23 1.6 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 3.7 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 30.7 bits (66), Expect = 0.011 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 378 YLVYDENTGDHKTQHELSDGSVVRGGYSLIQ-PDGYIREVKYVAD 509 Y+V N ++ + SDG +V G Y ++ DG +R V+Y AD Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIV-GEYGVVSHDDGSLRGVRYTAD 238 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 435 GSVVRGGYSLIQPDGYIREVKYVADDL 515 G + GY L PD ++R+ DD+ Sbjct: 81 GREIEVGYDLKSPDRFVRQFTICFDDV 107 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.2 bits (45), Expect = 3.7 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -1 Query: 250 GATRFGTTDPTGAADIWASCDPATAIDGAP---YCKYSTGTTSRPPCT 116 G+ + T P ++ + D +T + +P Y K T RPP T Sbjct: 413 GSDQRSTPSPRVYGNVNENQDCSTPTENSPTKPYYKLKTANNKRPPST 460 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,104 Number of Sequences: 336 Number of extensions: 2770 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -