BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l02f (562 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45775.2 68418.m05629 60S ribosomal protein L11 (RPL11D) 243 7e-65 At4g18730.1 68417.m02768 60S ribosomal protein L11 (RPL11C) 243 7e-65 At3g58700.1 68416.m06542 60S ribosomal protein L11 (RPL11B) ribo... 243 7e-65 At2g42740.1 68415.m05293 60S ribosomal protein L11 (RPL11A) 242 1e-64 At5g45775.1 68418.m05628 60S ribosomal protein L11 (RPL11D) 241 2e-64 At4g01310.1 68417.m00171 ribosomal protein L5 family protein con... 48 3e-06 At1g04840.1 68414.m00480 pentatricopeptide (PPR) repeat-containi... 37 0.011 At4g26330.1 68417.m03786 subtilase family protein contains simil... 29 2.1 At3g13880.1 68416.m01754 pentatricopeptide (PPR) repeat-containi... 29 2.8 At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical... 29 2.8 At4g14280.1 68417.m02201 hypothetical protein 28 4.9 At3g55160.1 68416.m06126 expressed protein 28 4.9 At3g06210.1 68416.m00714 expressed protein contains Prosite PS00... 27 6.5 At2g48100.2 68415.m06021 exonuclease family protein contains Pfa... 27 6.5 At2g48100.1 68415.m06020 exonuclease family protein contains Pfa... 27 6.5 At2g02980.1 68415.m00250 pentatricopeptide (PPR) repeat-containi... 27 6.5 At4g00670.1 68417.m00092 remorin family protein contains Pfam do... 27 8.6 >At5g45775.2 68418.m05629 60S ribosomal protein L11 (RPL11D) Length = 182 Score = 243 bits (594), Expect = 7e-65 Identities = 117/155 (75%), Positives = 132/155 (85%) Frame = +3 Query: 96 NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIA 275 N MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA Sbjct: 9 NPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIA 68 Query: 276 VHCTVRGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLD 455 + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+D Sbjct: 69 CYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMD 128 Query: 456 FYVVLGRPGFNVAHRRRKTGKVGFPHRLTKEDAMK 560 FYVVL RPG+ VA RRR +VG HR+TK+DAMK Sbjct: 129 FYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMK 163 >At4g18730.1 68417.m02768 60S ribosomal protein L11 (RPL11C) Length = 182 Score = 243 bits (594), Expect = 7e-65 Identities = 117/155 (75%), Positives = 132/155 (85%) Frame = +3 Query: 96 NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIA 275 N MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA Sbjct: 9 NPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIA 68 Query: 276 VHCTVRGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLD 455 + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+D Sbjct: 69 CYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMD 128 Query: 456 FYVVLGRPGFNVAHRRRKTGKVGFPHRLTKEDAMK 560 FYVVL RPG+ VA RRR +VG HR+TK+DAMK Sbjct: 129 FYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMK 163 >At3g58700.1 68416.m06542 60S ribosomal protein L11 (RPL11B) ribosomal protein L11, cytosolic, Arabidopsis thaliana, PIR:S49033 Length = 182 Score = 243 bits (594), Expect = 7e-65 Identities = 117/155 (75%), Positives = 132/155 (85%) Frame = +3 Query: 96 NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIA 275 N MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA Sbjct: 9 NPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIA 68 Query: 276 VHCTVRGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLD 455 + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+D Sbjct: 69 CYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMD 128 Query: 456 FYVVLGRPGFNVAHRRRKTGKVGFPHRLTKEDAMK 560 FYVVL RPG+ VA RRR +VG HR+TK+DAMK Sbjct: 129 FYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMK 163 >At2g42740.1 68415.m05293 60S ribosomal protein L11 (RPL11A) Length = 172 Score = 242 bits (592), Expect = 1e-64 Identities = 116/153 (75%), Positives = 131/153 (85%) Frame = +3 Query: 102 MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVH 281 MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA + Sbjct: 1 MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY 60 Query: 282 CTVRGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFY 461 TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DFY Sbjct: 61 VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY 120 Query: 462 VVLGRPGFNVAHRRRKTGKVGFPHRLTKEDAMK 560 VVL RPG+ VA RRR +VG HR+TK+DAMK Sbjct: 121 VVLERPGYRVARRRRCKARVGIQHRVTKDDAMK 153 >At5g45775.1 68418.m05628 60S ribosomal protein L11 (RPL11D) Length = 172 Score = 241 bits (590), Expect = 2e-64 Identities = 116/153 (75%), Positives = 131/153 (85%) Frame = +3 Query: 102 MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVH 281 MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA + Sbjct: 1 MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY 60 Query: 282 CTVRGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFY 461 TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DFY Sbjct: 61 VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY 120 Query: 462 VVLGRPGFNVAHRRRKTGKVGFPHRLTKEDAMK 560 VVL RPG+ VA RRR +VG HR+TK+DAMK Sbjct: 121 VVLERPGYRVARRRRCKTRVGIQHRVTKDDAMK 153 >At4g01310.1 68417.m00171 ribosomal protein L5 family protein contains Pfam profiles PF00673: ribosomal L5P family C-terminus, PF00281: ribosomal protein L5 Length = 262 Score = 48.4 bits (110), Expect = 3e-06 Identities = 30/130 (23%), Positives = 69/130 (53%), Gaps = 10/130 (7%) Frame = +3 Query: 96 NVMRNLHIRKLCLNICVGESGDR---LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNE 266 N+ + ++K+ +N +G++ L A K + +TGQ+P+ ++AR ++ +F IR ++ Sbjct: 79 NIHQVPKVQKIVVNCGIGDAAQNDKGLEAAMKDIALITGQKPIKTRARASIATFKIREDQ 138 Query: 267 KIAVHCTVRGAKAEEILERGL-----KVREYE-LRRDNFSATGNFGFGIQEH-IDLGIKY 425 + + T+RG L+R + + R+++ + +F GN+ G+++ + I++ Sbjct: 139 PLGIAVTLRGDVMYSFLDRLINLALPRTRDFQGVSPSSFDGNGNYSIGVKDQGVFPEIRF 198 Query: 426 DPSIGIYGLD 455 D G+D Sbjct: 199 DAVGKTRGMD 208 >At1g04840.1 68414.m00480 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 665 Score = 36.7 bits (81), Expect = 0.011 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 5/60 (8%) Frame = +3 Query: 309 EILERGLKVREYELRR--DNFSATGNFGFGIQEH---IDLGIKYDPSIGIYGLDFYVVLG 473 E+LE+GLK EY + S +G G GI+ H +D GIK D +IG +D Y G Sbjct: 283 EMLEKGLKPNEYTIAAVLSACSKSGALGSGIRIHGYILDNGIKLDRAIGTALVDMYAKCG 342 >At4g26330.1 68417.m03786 subtilase family protein contains similarity to SBT1, a subtilase from tomato plants GI:1771160 from [Lycopersicon esculentum] Length = 746 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -1 Query: 385 PKLPVAEKLSRRNSYSLTFKPLSRISSALAPRTVQWTAIFSLRRIPKDRTVYLA 224 P++ V K + +SY +TFKP S + WT L R+ V+L+ Sbjct: 687 PRILVFSKCQQEHSYYVTFKPTEIFSGRYVFGEIMWTN--GLHRVRSPVVVFLS 738 >At3g13880.1 68416.m01754 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 748 Score = 28.7 bits (61), Expect = 2.8 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +3 Query: 306 EEILERGLKVREYELRRDNFSATGNFGF-GIQEHIDLGIKYDPSIGIYGLDFYVVL 470 E+ +E L+ RE L+ D F+ G GF G + +DLG + + GL V L Sbjct: 130 EQAMELFLEAREANLKLDKFTYAGALGFCGERCDLDLGELLHGLVVVNGLSQQVFL 185 >At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121449 Length = 1188 Score = 28.7 bits (61), Expect = 2.8 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 268 FSLRRIPKDRTVYLALENTGCCPVSCSN-TLAARVSLSPDSPTHM 137 FSLR P DR+ E P CSN + ++ L P++ TH+ Sbjct: 243 FSLRTPPVDRSASRLEEECNLPPELCSNCSHGIKLGLCPEASTHV 287 >At4g14280.1 68417.m02201 hypothetical protein Length = 798 Score = 27.9 bits (59), Expect = 4.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 403 TLTWVSSTIPQLEFMDWTFTS 465 T TW SS +P L + W F S Sbjct: 167 TRTWKSSDVPMLPYTGWVFVS 187 >At3g55160.1 68416.m06126 expressed protein Length = 2149 Score = 27.9 bits (59), Expect = 4.9 Identities = 19/91 (20%), Positives = 43/91 (47%), Gaps = 6/91 (6%) Frame = +1 Query: 187 WSNSQDNS----LYFPR--LGIQCGLLVSVVMKRLLSIVQSEELKQKKSLRGV*KSENMN 348 W ++NS L+FP GI +V +++ +V S +++ + + EN++ Sbjct: 833 WDRLRENSFRILLHFPTPFTGISSEDMVQIIIPWAKQLVCSPRVRESDA-----ECENID 887 Query: 349 CGVTTSPPRVILASVFKNTLTWVSSTIPQLE 441 C S P+ + K+ + W+ +++ + E Sbjct: 888 CRNQNSKPKYPVVEYIKSLIQWLDASVTEGE 918 >At3g06210.1 68416.m00714 expressed protein contains Prosite PS00616: Histidine acid phosphatases phosphohistidine signature; Length = 840 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/46 (26%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 352 GVTTSPPRVILASVF--KNTLTWVSSTIPQLEFMDWTFTSYLAGQV 483 G+ + R+ +F + TLTW +S +P L + W + S ++ Sbjct: 182 GLREATTRIGRQEIFDRRTTLTWKNSEVPLLPYARWLYISSYVSRI 227 >At2g48100.2 68415.m06021 exonuclease family protein contains Pfam domain PF00929: exonuclease Length = 344 Score = 27.5 bits (58), Expect = 6.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 95 KCNAESSYQKALLEHMCW 148 K NAE YQK+ E+ CW Sbjct: 319 KMNAEELYQKSTSEYRCW 336 >At2g48100.1 68415.m06020 exonuclease family protein contains Pfam domain PF00929: exonuclease Length = 344 Score = 27.5 bits (58), Expect = 6.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 95 KCNAESSYQKALLEHMCW 148 K NAE YQK+ E+ CW Sbjct: 319 KMNAEELYQKSTSEYRCW 336 >At2g02980.1 68415.m00250 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 603 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 313 ISSALAPRTVQWTAIFSLRRIPKDRTVYLALENTGCCPVSCSNTL 179 I S L R +W + SLR++ KDR A++ GC + +N + Sbjct: 438 ILSNLYARNKKWEYVDSLRKVMKDRK---AVKVPGCSSIEVNNVV 479 >At4g00670.1 68417.m00092 remorin family protein contains Pfam domain, PF03763: Remorin, C-terminal region Length = 116 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 Query: 258 RNEKIAVHCTVRGAKAEEILERGLKVREYELRRDNFSATG 377 RNEK AVH + KA+ R ++ + E F A G Sbjct: 66 RNEKAAVHAKAQKKKADVQTRRAQEILDAEEAAARFQAAG 105 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,521,472 Number of Sequences: 28952 Number of extensions: 259069 Number of successful extensions: 735 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -