BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l01r (705 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 26 0.34 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 22 4.2 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.8 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 25.8 bits (54), Expect = 0.34 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 141 SCLDTFYITLYIIKILLHTRRAARTYNAI 227 SC D Y T Y + +H RR T N + Sbjct: 288 SCRDCSYATKYCHSLKIHLRRYGHTPNVV 316 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +3 Query: 141 SCLDTFYITLYIIKILLHTRR 203 SC D Y T Y + +H RR Sbjct: 46 SCRDCSYATKYCHSLKIHLRR 66 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +2 Query: 86 FFYCF*AYFVINRLATVCELFGYVLH 163 F+Y F F ++ L VC + Y +H Sbjct: 241 FYYAF-ILFTVHLLLLVCIYYFYYMH 265 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.8 Identities = 5/31 (16%), Positives = 19/31 (61%) Frame = +2 Query: 431 RYLSRLIHKYLSFFRVVTKKKYSLNFIKESL 523 ++ + +IH++ +F +++TK + + + + Sbjct: 1298 QFFAMMIHRFGTFSQIITKTQLDFDLCSKPI 1328 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.8 Identities = 5/31 (16%), Positives = 19/31 (61%) Frame = +2 Query: 431 RYLSRLIHKYLSFFRVVTKKKYSLNFIKESL 523 ++ + +IH++ +F +++TK + + + + Sbjct: 1298 QFFAMMIHRFGTFSQIITKTQLDFDLCSKPI 1328 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,951 Number of Sequences: 336 Number of extensions: 3302 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -