BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l01r (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17926| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_58943| Best HMM Match : rve (HMM E-Value=6.1e-13) 29 2.8 >SB_17926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1078 Score = 34.3 bits (75), Expect = 0.098 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = -2 Query: 221 IVCPSCSSRM*K--NFNNV*CDVKRIQTTHTQWPAYLLQSKPKNNKKSVFH 75 IVCP + ++ + +F ++ R +T HTQ P + +S P N KK+VFH Sbjct: 375 IVCPKKNGKLRRTVDFQSLELHATR-ETHHTQSPFHQARSVPHNKKKTVFH 424 >SB_58943| Best HMM Match : rve (HMM E-Value=6.1e-13) Length = 1134 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = -2 Query: 221 IVCPSCSSRM*K--NFNNV*CDVKRIQTTHTQWPAYLLQSKPKNNKKSVF 78 +VCP + + + +F ++ R +T HTQ P + +S P N KK+VF Sbjct: 266 VVCPKKNGKPHRTVDFQSLNLHATR-ETHHTQSPFHQARSMPHNKKKTVF 314 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,579,100 Number of Sequences: 59808 Number of extensions: 313868 Number of successful extensions: 598 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -