BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l01r (705 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78410-11|CAB01639.2| 315|Caenorhabditis elegans Hypothetical p... 33 0.20 Z81577-3|CAB04649.1| 528|Caenorhabditis elegans Hypothetical pr... 29 4.3 >Z78410-11|CAB01639.2| 315|Caenorhabditis elegans Hypothetical protein C51E3.4 protein. Length = 315 Score = 33.1 bits (72), Expect = 0.20 Identities = 29/92 (31%), Positives = 38/92 (41%), Gaps = 1/92 (1%) Frame = +3 Query: 15 ITFYVYNNYSFVHFFLVCNLMKNAFFIVFRLTL**IGWPLCVSCLDTFYITL-YIIKILL 191 I F V Y V+F L N F VFR L +G+ L T TL Y I + Sbjct: 179 IYFLVVIVYGIVYFLLKSNQASARFKSVFRSILVTVGFVLFGWVTTTLTNTLSYEITSVA 238 Query: 192 HTRRAARTYNAIHIDVGLLDNAIIKY*VNLLY 287 T + + Y I ++ NA I Y +N Y Sbjct: 239 FTAQLMQMYAGITVNFAAASNAFIFYAINSEY 270 >Z81577-3|CAB04649.1| 528|Caenorhabditis elegans Hypothetical protein R11.3 protein. Length = 528 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 Query: 160 TSHYTLLKFFYIREEQLGHTMLYILML 240 TS Y LLK Y R LG+T+L I M+ Sbjct: 119 TSQYELLKLVYSRSVNLGNTVLDIHMM 145 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,841,301 Number of Sequences: 27780 Number of extensions: 269694 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -