BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10l01f (636 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.6 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.6 Identities = 5/31 (16%), Positives = 19/31 (61%) Frame = -3 Query: 307 RYLSRLIHKYLSFFRVVTKKKYSLNFIKESL 215 ++ + +IH++ +F +++TK + + + + Sbjct: 1298 QFFAMMIHRFGTFSQIITKTQLDFDLCSKPI 1328 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.6 Identities = 5/31 (16%), Positives = 19/31 (61%) Frame = -3 Query: 307 RYLSRLIHKYLSFFRVVTKKKYSLNFIKESL 215 ++ + +IH++ +F +++TK + + + + Sbjct: 1298 QFFAMMIHRFGTFSQIITKTQLDFDLCSKPI 1328 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,252 Number of Sequences: 336 Number of extensions: 2810 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -