BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10k22f (650 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC010993-1|AAH10993.2| 337|Homo sapiens calcium binding protein... 31 3.6 AL138875-4|CAI10893.1| 337|Homo sapiens calcium binding protein... 31 3.6 AL138875-3|CAI10892.1| 280|Homo sapiens calcium binding protein... 31 3.6 AL136218-3|CAI10816.1| 337|Homo sapiens calcium binding protein... 31 3.6 AL136218-1|CAI10814.1| 280|Homo sapiens calcium binding protein... 31 3.6 AK022639-1|BAB14147.1| 289|Homo sapiens protein ( Homo sapiens ... 31 3.6 >BC010993-1|AAH10993.2| 337|Homo sapiens calcium binding protein 39-like protein. Length = 337 Score = 31.1 bits (67), Expect = 3.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 89 AEHHKDKNVDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMD 238 A HK + + + ++ Q K++ F + TDDE + K+Y I+ D Sbjct: 282 ASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRD 331 >AL138875-4|CAI10893.1| 337|Homo sapiens calcium binding protein 39-like protein. Length = 337 Score = 31.1 bits (67), Expect = 3.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 89 AEHHKDKNVDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMD 238 A HK + + + ++ Q K++ F + TDDE + K+Y I+ D Sbjct: 282 ASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRD 331 >AL138875-3|CAI10892.1| 280|Homo sapiens calcium binding protein 39-like protein. Length = 280 Score = 31.1 bits (67), Expect = 3.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 89 AEHHKDKNVDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMD 238 A HK + + + ++ Q K++ F + TDDE + K+Y I+ D Sbjct: 225 ASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRD 274 >AL136218-3|CAI10816.1| 337|Homo sapiens calcium binding protein 39-like protein. Length = 337 Score = 31.1 bits (67), Expect = 3.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 89 AEHHKDKNVDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMD 238 A HK + + + ++ Q K++ F + TDDE + K+Y I+ D Sbjct: 282 ASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRD 331 >AL136218-1|CAI10814.1| 280|Homo sapiens calcium binding protein 39-like protein. Length = 280 Score = 31.1 bits (67), Expect = 3.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 89 AEHHKDKNVDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMD 238 A HK + + + ++ Q K++ F + TDDE + K+Y I+ D Sbjct: 225 ASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRD 274 >AK022639-1|BAB14147.1| 289|Homo sapiens protein ( Homo sapiens cDNA FLJ12577 fis, clone NT2RM4001047, highly similar to MO25 PROTEIN. ). Length = 289 Score = 31.1 bits (67), Expect = 3.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 89 AEHHKDKNVDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMD 238 A HK + + + ++ Q K++ F + TDDE + K+Y I+ D Sbjct: 234 ASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRD 283 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,391,270 Number of Sequences: 237096 Number of extensions: 1739545 Number of successful extensions: 3461 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3461 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7253890590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -