BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10k19f (605 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66130.1 68418.m08331 cell cycle checkpoint protein-related w... 30 1.4 At5g01730.1 68418.m00091 expressed protein 29 3.2 At2g46370.2 68415.m05771 auxin-responsive GH3 family protein sim... 29 3.2 At2g46370.1 68415.m05770 auxin-responsive GH3 family protein sim... 29 3.2 At4g16640.1 68417.m02515 matrix metalloproteinase, putative meta... 28 4.2 At4g03890.1 68417.m00546 hypothetical protein contains Pfam prof... 28 4.2 At1g64140.1 68414.m07266 expressed protein similar to putative d... 28 4.2 At3g50720.1 68416.m05549 protein kinase, putative similar to pro... 27 9.6 >At5g66130.1 68418.m08331 cell cycle checkpoint protein-related weak similarity to cell cycle checkpoint protein RAD17 [Homo sapiens] GI:4102916 Length = 599 Score = 29.9 bits (64), Expect = 1.4 Identities = 24/102 (23%), Positives = 44/102 (43%) Frame = +1 Query: 100 VTTRLCREVDASACTVNEVRIDPCVNSRLCHLKKGKNAKVSFDFTPQFSTTKLKTGLFGL 279 V R+CRE C V + ID + ++ + F P+ + TK+K+ G+ Sbjct: 298 VLQRICRE---EHCKVTTMEIDQMATASGGDIRHAITSLQLFSVKPELNHTKIKSPRPGM 354 Query: 280 KNGAEIPFDALYNADACTLTSCPTEAGKTQTLDFSLHIGKKL 405 ++ +Y+ ++SC G+ +TL +GK L Sbjct: 355 EDNYHGNEQTMYSGLDSGISSC---FGRDETLSLFHALGKFL 393 >At5g01730.1 68418.m00091 expressed protein Length = 1192 Score = 28.7 bits (61), Expect = 3.2 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 1/97 (1%) Frame = +1 Query: 121 EVDASACTVNEVRIDPCVN-SRLCHLKKGKNAKVSFDFTPQFSTTKLKTGLFGLKNGAEI 297 + +A AC V EVR DP +N S HL K +V D + +F ++ +EI Sbjct: 526 KANAEACEVFEVRRDPMLNISPETHLL--KVTQVPQDAYEGGTNDVHSQHVFSVETASEI 583 Query: 298 PFDALYNADACTLTSCPTEAGKTQTLDFSLHIGKKLP 408 AL ++T+ EA +++ D S G +P Sbjct: 584 SVSALVEDQFSSITNQEIEALESE--DISSEAGHFIP 618 >At2g46370.2 68415.m05771 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 575 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +1 Query: 361 KTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNES--QMCC 471 K + +DFS +I G++ W++ E NE Q CC Sbjct: 456 KIEVIDFSSYIDVSTDPGHYAIFWEISGETNEDVLQDCC 494 >At2g46370.1 68415.m05770 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 575 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +1 Query: 361 KTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNES--QMCC 471 K + +DFS +I G++ W++ E NE Q CC Sbjct: 456 KIEVIDFSSYIDVSTDPGHYAIFWEISGETNEDVLQDCC 494 >At4g16640.1 68417.m02515 matrix metalloproteinase, putative metalloproteinase [Arabidopsis thaliana] GI:3128477; contains InterPro accession IPR001818: Matrixin Length = 364 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 217 VSFDFTPQFSTTKLKTGLFGLKNGAEIPFDAL 312 VSF+ F+T LK G + +G +PFD + Sbjct: 199 VSFEEVDDFTTADLKIGFYAGDHGDGLPFDGV 230 >At4g03890.1 68417.m00546 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 301 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 286 GAEIPFDALYNADACTLTSCPTE 354 G EI F+ +YN D T T PTE Sbjct: 241 GREIRFEEVYNEDVQTRTKAPTE 263 >At1g64140.1 68414.m07266 expressed protein similar to putative disease resistance protein GB:CAB40943 GI:4586107 from [Arabidopsis thaliana]; weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 646 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Frame = +1 Query: 316 NADACTLTSCPTEAGKTQT----LDFSLHIGKKLPTGN 417 +A ACT S E + + LDFSLH+G + PT + Sbjct: 84 SATACTSLSSARETEEASSMDIELDFSLHLGNEKPTAS 121 >At3g50720.1 68416.m05549 protein kinase, putative similar to protein kinase ATN1 [Arabidopsis thaliana] gi|1054633|emb|CAA63387 Length = 377 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 251 LNSRPASLG*RMALKFLLMLSTMLTLAHSRHV 346 LNSRP+ L +++L F L +S + HS+ + Sbjct: 138 LNSRPSPLDLKVSLSFALDISRAMEYLHSKGI 169 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,664,225 Number of Sequences: 28952 Number of extensions: 286592 Number of successful extensions: 750 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -