BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10k16r (679 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 27 0.16 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.5 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.2 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 6.2 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.16 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 575 RAPANTSWESGASALEHALKLESDVTNSI 489 R P SW S + + A KL+ ++ NSI Sbjct: 149 RTPTEASWHSPEAHISVAQKLQKEIPNSI 177 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 487 RMLLVTSLSSLRACSRADAPLSHDVFAGALYVMRSV 594 R+LL++++ + CS + L D+F G ++R V Sbjct: 10 RILLISAVFCVGLCSEDEERLVRDLFRGYNKLIRPV 45 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.5 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = -2 Query: 597 RNRPHHVQGPRKHVVGERRISPRARPQAGE*RHQQHPGGHQDLREQLQRLPPG 439 +++P H Q H + +A+PQ + + QQ P Q ++Q Q+ G Sbjct: 806 QSQPPHQQ-LHHHQSTHPQAQAQAQPQQQQQQQQQQPQQQQQQQQQQQQQQRG 857 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 384 RRQGLDPQEDDGQTRRPRRVHLRQETPRIE 295 R+Q +DP + Q R RRV + + +E Sbjct: 96 RKQTIDPLSSNTQITRKRRVGIVENQYAVE 125 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -2 Query: 465 EQLQRLPPGRLFVRGIPR 412 ++L++LP G LF++ + R Sbjct: 1321 DRLRQLPEGSLFIKEVDR 1338 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/43 (25%), Positives = 16/43 (37%) Frame = -2 Query: 396 PTRPRRQGLDPQEDDGQTRRPRRVHLRQETPRIERINILHVTP 268 P +R G E+ P+R+ P + R H TP Sbjct: 622 PVTTKRDGTQETEERLPPLPPKRIRKMPSMPLLPRPISCHTTP 664 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,445 Number of Sequences: 438 Number of extensions: 4204 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -