BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10k15r (730 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1274 + 28897491-28897707,28897804-28897935,28898029-288980... 28 6.6 10_07_0057 + 12460986-12461036,12461108-12461161,12461420-124614... 28 8.7 06_01_1082 - 8847795-8848033,8848511-8848724 28 8.7 04_04_1571 + 34504087-34504421,34505002-34505731,34506091-345120... 28 8.7 >06_03_1274 + 28897491-28897707,28897804-28897935,28898029-28898096, 28898216-28898280,28898468-28898534,28898630-28898917, 28898995-28899102,28899236-28899487,28899918-28899997, 28900092-28900185,28900728-28900810,28901319-28901873, 28902085-28902616 Length = 846 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -3 Query: 176 YENDVLFFIYNRQFNDALELGTIVNASGDRKAVGHDGEVAGLPD 45 Y V FF YN+ F+ + + T+V +G+ ++G G + L D Sbjct: 764 YSGSVGFFSYNKTFDLNIVIRTVVLHNGE-ASIGAGGAIVALSD 806 >10_07_0057 + 12460986-12461036,12461108-12461161,12461420-12461482, 12461666-12461716,12461996-12462057,12462156-12462318, 12462829-12462939,12463029-12463166,12463248-12463322, 12463420-12463540,12464827-12464981,12465080-12465154, 12465270-12465473,12465670-12465786 Length = 479 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 487 MMSLKFNGKYFLTISCPLPTHSL*QYSMVFRLLSMI 594 MM L GK I CP+P+HSL SMV R +++ Sbjct: 152 MMHLLIRGKKD-GILCPIPSHSLYTDSMVLRGATLV 186 >06_01_1082 - 8847795-8848033,8848511-8848724 Length = 150 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -3 Query: 242 RVVYGGNSADSTR--EQWFFQPAKYENDVLFFIYNRQFNDALELG 114 + Y G++A R + W Y DVL F YN++++D +G Sbjct: 42 KTYYVGDAAGWGRNLDWWLAGKTFYAGDVLVFKYNKEYHDVAVVG 86 >04_04_1571 + 34504087-34504421,34505002-34505731,34506091-34512077, 34512493-34513964,34514114-34514377,34514761-34514978, 34515759-34516030,34516190-34516559,34516578-34516797, 34516819-34518931,34518941-34519193,34519269-34519401, 34520597-34521114,34521207-34522115,34522195-34522368, 34522833-34522882,34523963-34524035,34524413-34524477, 34524736-34525522,34525622-34525878,34525989-34526109, 34526315-34526956 Length = 5320 Score = 27.9 bits (59), Expect = 8.7 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = -3 Query: 719 QDLEEKLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRNTMEYCYKLWVG 540 Q LE N I+T D +RQ L S++ N++ + +D + +E C +WVG Sbjct: 1147 QLLELGKNNEIVT---DQVLRQELALVMPKIYSLLSNLIGSDEMDIVKVVLEGCRWIWVG 1203 Query: 539 NG 534 +G Sbjct: 1204 DG 1205 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,222,658 Number of Sequences: 37544 Number of extensions: 395601 Number of successful extensions: 1138 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1138 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -