BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10k15r (730 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) 25 1.7 SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 29 5.1 SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_20858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_53155| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/64 (29%), Positives = 26/64 (40%) Frame = +2 Query: 539 CRPTACSSTPWCSVSCQ*SGC*LHSG*WSPCLGSHIPSSDGQHCRSRR*GCCCTVSPRGL 718 C+ CS++ C SC GC L+ + + C+SR G CT S G Sbjct: 224 CQQVVCSASGKCDQSCDGEGCNLYCSEGAKTCNQKCQGACVTDCKSRWCGVTCTGS--GC 281 Query: 719 G*KC 730 KC Sbjct: 282 DVKC 285 >SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) Length = 290 Score = 25.4 bits (53), Expect(2) = 1.7 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = -3 Query: 605 VNNLIIDKRRNTMEYCYKLWVGNGQEIV 522 +++L++ +++ YC+ NGQ+IV Sbjct: 130 IHDLLLSLQKHLFAYCHNATSNNGQDIV 157 Score = 23.4 bits (48), Expect(2) = 1.7 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = -3 Query: 524 VRKYFPLNFRLIMAGNYVKIIYRNYNLALKLGSTTNPSNERIAYGDGVDKH 372 +R YF L+M+G ++ + +L L S R+ G G D H Sbjct: 183 IRYYFACFQELLMSGPANSLLQSHLSLFLPCAGEILGSVYRLLVGHGSDTH 233 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 28.7 bits (61), Expect = 5.1 Identities = 27/74 (36%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = -3 Query: 440 LKLGSTTNPSNERIAYGDGVDKHTELVSWKFITLWENNRVYFKIHNTKYNQYLKMS---- 273 L+ GST S++ IA +T L S F R Y H T Y YL +S Sbjct: 868 LESGSTLLASDDGIAPNKRTKVYTSLSSDVFY------RFYVYAHTT-YTTYLCLSVNAP 920 Query: 272 -TTTCNCNSRDRVV 234 T C NSRDRV+ Sbjct: 921 CTQACRLNSRDRVL 934 >SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 7645 Score = 28.3 bits (60), Expect = 6.7 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 1/94 (1%) Frame = +3 Query: 402 SLIRGIGCGTELQSEVVVSVNDLDIVSGHDESKV*WEVLSNNFLSVADPQLVAVLHG-VP 578 S++ G E V++ +N+ IV + K+ + +++ +V ++ V Sbjct: 6471 SVVEAFEAG-ETSKPVMIPINEDKIVEDTETFKLLLSSIEPTVTVISNQTIVNIIDDDVI 6529 Query: 579 SLVNDQVVNYILDDGXXXXXXIFQALTDSTVVVA 680 ++N VVN I +DG Q+LT +++ Sbjct: 6530 VIINQTVVNIIDNDGKLSSSSTRQSLTSLMTILS 6563 >SB_20858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 504 KL*THHGRKLCQDHLQKLQPRSEAR 430 +L HHGR+L +DHL PR R Sbjct: 199 RLLKHHGRELIKDHLDLPLPRQPKR 223 >SB_53155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 412 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/66 (27%), Positives = 29/66 (43%) Frame = -3 Query: 491 IMAGNYVKIIYRNYNLALKLGSTTNPSNERIAYGDGVDKHTELVSWKFITLWENNRVYFK 312 ++ G Y +++R ++ + G+ T SNER V K + F W VYF Sbjct: 217 VITGLYSGVVHRLWHRKVP-GNQTTSSNERAKSKKRVLKMLVAIVLAFALCWLPYHVYFF 275 Query: 311 IHNTKY 294 + N Y Sbjct: 276 LENYYY 281 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,984,745 Number of Sequences: 59808 Number of extensions: 453499 Number of successful extensions: 1256 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1254 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -