BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10k09f (584 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 24 0.96 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 3.9 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.9 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 21 8.9 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 21 8.9 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 8.9 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 8.9 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.9 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 24.2 bits (50), Expect = 0.96 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = -2 Query: 385 LNNSLWLHYVCHSDKVFAFSELSSPISFCRRNSRSFLLIRFFPVR*PKLIEHIRSPRMRK 206 L S + YV ++V+ L + S + + PVR L ++ S MR Sbjct: 220 LRLSRLVRYVSQWEEVYILQNLQKKRTRAEGRLSSDNMSKKSPVRKATLFLNMASVFMRI 279 Query: 205 FSLICVV 185 F+LIC++ Sbjct: 280 FNLICMM 286 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 86 GDAFITPAANNTIRIHRRCG 27 G +ITP ++IH CG Sbjct: 311 GYKYITPLIQKHLKIHDTCG 330 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 358 HNVTKDYYLERLEGDG 405 H+VT+ L RL GDG Sbjct: 132 HDVTERNKLVRLSGDG 147 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 212 HSGTPNVFN*LRSTNRKET 268 H+ N+F ++STN K T Sbjct: 56 HNHIQNIFKIIKSTNEKIT 74 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 212 HSGTPNVFN*LRSTNRKET 268 H+ N+F ++STN K T Sbjct: 39 HNHIQNIFKIIKSTNEKIT 57 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.0 bits (42), Expect = 8.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 409 YRTLNMPPPTAKLEFGVFRRYPIRLKIIENEY 504 YRTL P +++ EF V R + +N Y Sbjct: 271 YRTLFFHPLSSRREFAVSTRILRDENLSQNSY 302 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 21.0 bits (42), Expect = 8.9 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 411 VKTVALKTL*IIVFGYIM 358 ++T A KTL IIV G+I+ Sbjct: 3 METKAAKTLGIIVGGFIL 20 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.0 bits (42), Expect = 8.9 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 411 VKTVALKTL*IIVFGYIM 358 ++T A KTL IIV G+I+ Sbjct: 451 METKAAKTLGIIVGGFIL 468 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,195 Number of Sequences: 438 Number of extensions: 3841 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -